Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34940 163 / 2e-48 ARO1 armadillo repeat only 1 (.1) AT4G36030 132 / 4e-37 ARO3 armadillo repeat only 3 (.1) AT5G66200 115 / 3e-31 ARO2 armadillo repeat only 2 (.1) AT3G26600 55 / 8e-10 ARO4 armadillo repeat only 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005065 [exp] 195 / 1e-65 AT4G34940 239 / 2e-76 armadillo repeat only 1 (.1) Lus10027838 [exp] 197 / 2e-65 AT4G34940 396 / 2e-135 armadillo repeat only 1 (.1) Lus10025059 [exp] 208 / 5e-65 AT4G34940 973 / 0.0 armadillo repeat only 1 (.1) Lus10027837 [exp] 198 / 4e-63 AT4G34940 574 / 0.0 armadillo repeat only 1 (.1) Lus10028452 [exp] 140 / 5e-40 AT5G66200 965 / 0.0 armadillo repeat only 2 (.1) Lus10041905 [exp] 139 / 2e-39 AT5G66200 966 / 0.0 armadillo repeat only 2 (.1) Lus10037087 [exp] 90 / 2e-23 AT5G66200 221 / 1e-68 armadillo repeat only 2 (.1) Lus10036897 [exp] 67 / 5e-14 AT5G66200 261 / 2e-79 armadillo repeat only 2 (.1) Lus10026695 [exp] 47 / 4e-07 AT3G26600 656 / 0.0 armadillo repeat only 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G131900 [exp] 176 / 3e-53 AT4G34940 986 / 0.0 armadillo repeat only 1 (.1) Potri.004G172500 [exp] 172 / 1e-51 AT4G34940 1020 / 0.0 armadillo repeat only 1 (.1) Potri.005G113000 [exp] 140 / 5e-40 AT5G66200 966 / 0.0 armadillo repeat only 2 (.1) Potri.015G082800 [exp] 60 / 1e-11 AT3G26600 610 / 0.0 armadillo repeat only 4 (.1) Potri.010G045500 [exp] 56 / 3e-10 AT3G26600 632 / 0.0 armadillo repeat only 4 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034486 pacid=23175921 polypeptide=Lus10034486 locus=Lus10034486.g ID=Lus10034486.BGIv1.0 annot-version=v1.0 ATGGAGGCAGAGGTGGCGCTCAACAAGTTCGCGTCCACCGAGACCTTCCTATGCGTGATCCATTCGAAAGTCCTGATTAGTGCTGGAGGGACAAAGCATT TGATTCAGCTAGTCTACCTCGGGGAGCAGGTGATCCAAACTCCTTCGCTAATTCTCCTGTGTTACATCACCATGAATTGTCCCGACAGCGGCGTTCTCGC CAACGAGGAAGTGTTGATCTTGCTTGAGTGGTCGACGAAGCAAGCCCACTTGGTGGAGAATGTCGCGATTCAAAACTTGTTGCCGGAGGCCAAGAGTAGA TTGGAGCTCTGTCAATCGAGAGTGTCAAGAGGGTTCCATTAA
AA sequence Show only first row Show all	>Lus10034486 pacid=23175921 polypeptide=Lus10034486 locus=Lus10034486.g ID=Lus10034486.BGIv1.0 annot-version=v1.0 MEAEVALNKFASTETFLCVIHSKVLISAGGTKHLIQLVYLGEQVIQTPSLILLCYITMNCPDSGVLANEEVLILLEWSTKQAHLVENVAIQNLLPEAKSR LELCQSRVSRGFH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34940		ARO1	armadillo repeat only 1 (.1)		Lus10034486 [exp]	0	1
AT5G57280		RID2	root initiation defective 2, S...		Lus10020005 [exp]	8.1	0.7571
AT1G75130		CYP721A1	"cytochrome P450, family 721, ...		Lus10010802 [exp]	41.7	0.7474
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10012038 [exp]	73.2	0.7308
AT3G52570			alpha/beta-Hydrolases superfam...		Lus10014222 [exp]	113.0	0.7141
AT3G10080			RmlC-like cupins superfamily p...		Lus10020631 [exp]	148.4	0.6897
AT3G15130			Tetratricopeptide repeat (TPR)...		Lus10030124 [exp]	169.1	0.6809
AT1G80080		AtRLP17, TMM	TOO MANY MOUTHS, Receptor Like...		Lus10042458 [exp]	187.8	0.6795
AT5G35400			Pseudouridine synthase family ...		Lus10022949 [exp]	198.7	0.6763

Compare expression of checked genes

Lus10034486 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.