Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34970 202 / 2e-68 ADF9 actin depolymerizing factor 9 (.1) AT2G16700 200 / 8e-68 ADF5, ATADF5 actin depolymerizing factor 5 (.1.2) AT2G31200 166 / 5e-54 ADF6, ATADF6 actin depolymerizing factor 6 (.1) AT4G00680 164 / 2e-53 ADF8 actin depolymerizing factor 8 (.1) AT1G01750 160 / 1e-51 ADF11 actin depolymerizing factor 11 (.1) AT4G25590 158 / 5e-51 ADF7 actin depolymerizing factor 7 (.1) AT5G59890 157 / 6e-51 ADF4, ATADF4 actin depolymerizing factor 4 (.1.2) AT3G46010 157 / 2e-50 ATADF1, ADF1 actin depolymerizing factor 1 (.1.2) AT5G59880 152 / 7e-49 ADF3 actin depolymerizing factor 3 (.1.2) AT3G46000 152 / 8e-49 ADF2 actin depolymerizing factor 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025049 [exp] 242 / 3e-84 AT2G16700 232 / 9e-80 actin depolymerizing factor 5 (.1.2) Lus10024885 [exp] 177 / 2e-58 AT2G31200 230 / 3e-79 actin depolymerizing factor 6 (.1) Lus10022933 [exp] 176 / 7e-58 AT2G31200 254 / 9e-89 actin depolymerizing factor 6 (.1) Lus10024418 [exp] 172 / 2e-56 AT5G59890 249 / 6e-87 actin depolymerizing factor 4 (.1.2) Lus10024417 [exp] 167 / 1e-54 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2) Lus10025319 [exp] 167 / 1e-54 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2) Lus10008489 [exp] 152 / 2e-48 AT1G01750 192 / 2e-64 actin depolymerizing factor 11 (.1) Lus10027474 [exp] 147 / 2e-46 AT5G52360 244 / 6e-85 actin depolymerizing factor 10 (.1) Lus10039229 [exp] 146 / 2e-46 AT5G52360 231 / 6e-80 actin depolymerizing factor 10 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G133100 [exp] 218 / 9e-75 AT2G16700 257 / 7e-90 actin depolymerizing factor 5 (.1.2) Potri.004G173800 [exp] 216 / 5e-74 AT2G16700 255 / 4e-89 actin depolymerizing factor 5 (.1.2) Potri.005G223800 [exp] 172 / 1e-56 AT2G31200 225 / 5e-77 actin depolymerizing factor 6 (.1) Potri.002G038800 [exp] 169 / 3e-55 AT2G31200 241 / 2e-83 actin depolymerizing factor 6 (.1) Potri.001G236700 [exp] 161 / 3e-52 AT5G59890 256 / 2e-89 actin depolymerizing factor 4 (.1.2) Potri.008G052100 [exp] 159 / 2e-51 AT5G59890 249 / 1e-86 actin depolymerizing factor 4 (.1.2) Potri.009G028100 [exp] 159 / 2e-51 AT5G59890 256 / 1e-89 actin depolymerizing factor 4 (.1.2) Potri.009G028200 [exp] 159 / 3e-51 AT5G59890 258 / 4e-90 actin depolymerizing factor 4 (.1.2) Potri.001G236400 [exp] 158 / 5e-51 AT5G59890 246 / 1e-85 actin depolymerizing factor 4 (.1.2) Potri.015G144500 [exp] 158 / 6e-51 AT4G25590 257 / 6e-90 actin depolymerizing factor 7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0092 [flax] [poplar] ADF PF00241 [flax] [poplar] Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Representative CDS sequence Show only first row Show all	>Lus10034494 pacid=23175891 polypeptide=Lus10034494 locus=Lus10034494.g ID=Lus10034494.BGIv1.0 annot-version=v1.0 ATGGCGATGAAGTGGAAGAAGGTCCACCGCTACATAGTCTTCAAGATCGACGAGAAGACCGGCCTCGTCGCCGTCGACAAAGTTGGCGGCCCAGGCGAGA GCTACGATGACCTCGCCGCCTCCTTGCCCGACGACGACTGCCGCTACGCCGTCTTCGATTTCGACTTCGTCACCGTCGACAACTGCCGCAAGAGCAAGAT CTTCTTCATTGCCTGGGCACCGGCTGCGTCGAGGATCAGAGCAAAGATGATGTATGCGACATCGAAGATCGGAGTGAAGGGCGCATTGGATGGGATCCAT TACGAGCTTCAAGCGACCGACCCGGCCGAAATGGGGTTCGATGTGATCAAGAGTCAAGCCAAGTGA
AA sequence Show only first row Show all	>Lus10034494 pacid=23175891 polypeptide=Lus10034494 locus=Lus10034494.g ID=Lus10034494.BGIv1.0 annot-version=v1.0 MAMKWKKVHRYIVFKIDEKTGLVAVDKVGGPGESYDDLAASLPDDDCRYAVFDFDFVTVDNCRKSKIFFIAWAPAASRIRAKMMYATSKIGVKGALDGIH YELQATDPAEMGFDVIKSQAK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34970		ADF9	actin depolymerizing factor 9 ...		Lus10034494 [exp]	0	1
AT2G16700		ADF5, ATADF5	actin depolymerizing factor 5 ...		Lus10025049 [exp]	1.7	0.8124
AT5G45100		BRG1	BOI-related gene 1, SBP (S-rib...		Lus10040613 [exp]	1.7	0.7642
AT2G34690		ACD11	ACCELERATED CELL DEATH 11, Gly...		Lus10023267 [exp]	2.4	0.8071
AT2G31800			Integrin-linked protein kinase...		Lus10008350 [exp]	3.9	0.7505
AT1G13340			Regulator of Vps4 activity in ...		Lus10041468 [exp]	5.3	0.7641
AT4G10270			Wound-responsive family protei...		Lus10033729 [exp]	9.2	0.7410
AT3G09770		LOG2	LOSS OF GDU 2, RING/U-box supe...		Lus10041300 [exp]	11.4	0.6987
AT5G13170		SAG29, SWEET15,...	senescence-associated gene 29 ...		Lus10043190 [exp]	12.7	0.6740
AT5G20700			Protein of unknown function (D...		Lus10022948 [exp]	13.0	0.7313
AT5G03795			Exostosin family protein (.1)		Lus10039142 [exp]	15.9	0.6858

Compare expression of checked genes

Lus10034494 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.