Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35985 87 / 4e-21 Senescence/dehydration-associated protein-related (.1) AT3G51250 83 / 2e-19 Senescence/dehydration-associated protein-related (.1) AT2G17840 80 / 2e-18 ERD7 EARLY-RESPONSIVE TO DEHYDRATION 7, Senescence/dehydration-associated protein-related (.1) AT3G21600 55 / 1e-09 Senescence/dehydration-associated protein-related (.1.2) AT4G15450 49 / 1e-07 Senescence/dehydration-associated protein-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014132 [exp] 192 / 2e-60 AT2G17840 476 / 1e-166 EARLY-RESPONSIVE TO DEHYDRATION 7, Senescence/dehydration-associated protein-related (.1) Lus10027840 [exp] 108 / 2e-28 AT2G17840 489 / 4e-169 EARLY-RESPONSIVE TO DEHYDRATION 7, Senescence/dehydration-associated protein-related (.1) Lus10005067 [exp] 107 / 2e-28 AT2G17840 459 / 5e-160 EARLY-RESPONSIVE TO DEHYDRATION 7, Senescence/dehydration-associated protein-related (.1) Lus10028439 [exp] 86 / 1e-20 AT3G51250 520 / 0.0 Senescence/dehydration-associated protein-related (.1) Lus10041892 [exp] 80 / 1e-18 AT3G51250 358 / 9e-122 Senescence/dehydration-associated protein-related (.1) Lus10043028 [exp] 42 / 5e-05 AT4G15450 373 / 3e-128 Senescence/dehydration-associated protein-related (.1) Lus10011127 [exp] 42 / 5e-05 AT4G15450 382 / 8e-132 Senescence/dehydration-associated protein-related (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G174100 [exp] 100 / 5e-26 AT2G17840 472 / 7e-165 EARLY-RESPONSIVE TO DEHYDRATION 7, Senescence/dehydration-associated protein-related (.1) Potri.009G133500 [exp] 87 / 7e-21 AT2G17840 449 / 1e-156 EARLY-RESPONSIVE TO DEHYDRATION 7, Senescence/dehydration-associated protein-related (.1) Potri.005G111600 [exp] 86 / 9e-21 AT2G17840 491 / 3e-172 EARLY-RESPONSIVE TO DEHYDRATION 7, Senescence/dehydration-associated protein-related (.1) Potri.018G087500 [exp] 51 / 3e-08 AT4G15450 401 / 5e-139 Senescence/dehydration-associated protein-related (.1) Potri.006G164748 [exp] 42 / 3e-05 AT4G15450 332 / 3e-112 Senescence/dehydration-associated protein-related (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06911 [flax] [poplar] Senescence Senescence-associated protein
Representative CDS sequence Show only first row Show all	>Lus10034498 pacid=23175905 polypeptide=Lus10034498 locus=Lus10034498.g ID=Lus10034498.BGIv1.0 annot-version=v1.0 ATGGCGTCTCCCTACCAGAAACCCCTCTACCCAGAAGTCTATTACTCAAACCCAGAAAAACCCACTTCTTCCTCCTCCTCCGCACCATCTCTTTACCCGA CAATCGACCCCTCGGATTTCGTCGATAACCCCTTCGCCACCGATAACGGCGCCACCGCTTGCGCGCCTCCTCCTCGCGAGGAGGTCCTGATCAGAATCCC AGGAGCAATAGTCCACATGATCGAGAAAGACTACAGCGTGGAGCTCGCCAGCGGCGACTTACAAATCGTCACTCTCAAGCAAGGCGAAACCTTCGTTGCG GCATTTTGTCGAATAGGTGGCGAGCACGACCACATCCAGTGGCCGCTGGCGAAAGACGAGGAAGGCGCGAAGCATCAGCAGTGA
AA sequence Show only first row Show all	>Lus10034498 pacid=23175905 polypeptide=Lus10034498 locus=Lus10034498.g ID=Lus10034498.BGIv1.0 annot-version=v1.0 MASPYQKPLYPEVYYSNPEKPTSSSSSAPSLYPTIDPSDFVDNPFATDNGATACAPPPREEVLIRIPGAIVHMIEKDYSVELASGDLQIVTLKQGETFVA AFCRIGGEHDHIQWPLAKDEEGAKHQQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G51250			Senescence/dehydration-associa...		Lus10034498 [exp]	0	1
AT4G12320		CYP706A6	"cytochrome P450, family 706, ...		Lus10024586 [exp]	8.7	0.8411
AT1G76180		ERD14	EARLY RESPONSE TO DEHYDRATION ...		Lus10021827 [exp]	16.6	0.8333
AT1G65730		YSL7	YELLOW STRIPE like 7 (.1)		Lus10043408 [exp]	28.8	0.8190
AT5G60850	DOF	OBP4, AtDof5. 4	OBF binding protein 4 (.1)		Lus10034652 [exp]	30.0	0.8331
AT1G51630			O-fucosyltransferase family pr...		Lus10035749 [exp]	31.9	0.8322
AT2G17840		ERD7	EARLY-RESPONSIVE TO DEHYDRATIO...		Lus10014132 [exp]	32.2	0.8278
AT5G15740		RRT1	O-fucosyltransferase family pr...		Lus10034651 [exp]	37.9	0.8180
AT3G53380			Concanavalin A-like lectin pro...		Lus10026493 [exp]	42.5	0.7975
AT3G02700			NC domain-containing protein-r...		Lus10010962 [exp]	50.0	0.8106
AT5G53750			CBS domain-containing protein ...		Lus10042702 [exp]	50.9	0.8063

Compare expression of checked genes

Lus10034498 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.