Lus10034504 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G22640 62 / 5e-13 EMB1211 embryo defective 1211, MORN (Membrane Occupation and Recognition Nexus) repeat-containing protein (.1), MORN (Membrane Occupation and Recognition Nexus) repeat-containing protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009392 101 / 9e-27 AT5G22640 765 / 0.0 embryo defective 1211, MORN (Membrane Occupation and Recognition Nexus) repeat-containing protein (.1), MORN (Membrane Occupation and Recognition Nexus) repeat-containing protein (.2)
Lus10020545 95 / 2e-24 AT5G22640 743 / 0.0 embryo defective 1211, MORN (Membrane Occupation and Recognition Nexus) repeat-containing protein (.1), MORN (Membrane Occupation and Recognition Nexus) repeat-containing protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G149100 57 / 3e-11 AT5G22640 753 / 0.0 embryo defective 1211, MORN (Membrane Occupation and Recognition Nexus) repeat-containing protein (.1), MORN (Membrane Occupation and Recognition Nexus) repeat-containing protein (.2)
PFAM info
Representative CDS sequence
>Lus10034504 pacid=23162745 polypeptide=Lus10034504 locus=Lus10034504.g ID=Lus10034504.BGIv1.0 annot-version=v1.0
ATGGAAGGAGCGGATTTGAAGGAGTACTGGGCGGATCCTCCTCTGCATGTGAGGAAACTCGGGTGGGACCCGTACGAGGCCGATAGTGAGGATTGGGATG
TGGTGTATGATGAAATTCATCGAGGGAAGGATCCAAAGATTGAGCCTTTTTATGTGCCGTACAGGAAGCCTTACCCTGTTGTTCCGGATAATCAAGCTGA
TATTAAGAACCCTAAGGATGTGGTTTAG
AA sequence
>Lus10034504 pacid=23162745 polypeptide=Lus10034504 locus=Lus10034504.g ID=Lus10034504.BGIv1.0 annot-version=v1.0
MEGADLKEYWADPPLHVRKLGWDPYEADSEDWDVVYDEIHRGKDPKIEPFYVPYRKPYPVVPDNQADIKNPKDVV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G22640 EMB1211 embryo defective 1211, MORN (M... Lus10034504 0 1
AT5G44440 FAD-binding Berberine family p... Lus10023367 3.2 0.8542
AT2G25660 EMB2410 embryo defective 2410 (.1) Lus10022111 9.2 0.8493
AT5G66550 Maf-like protein (.1) Lus10040204 10.6 0.8428
AT5G48830 unknown protein Lus10038165 12.1 0.8789
AT4G24750 Rhodanese/Cell cycle control p... Lus10019454 12.6 0.8647
AT1G06240 Protein of unknown function DU... Lus10033620 16.7 0.8565
AT1G01080 RNA-binding (RRM/RBD/RNP motif... Lus10002676 21.4 0.8549
AT1G74710 ATICS1, SID2, E... SALICYLIC ACID INDUCTION DEFIC... Lus10023622 23.6 0.8493
AT2G44590 ADL1D DYNAMIN-like 1D (.1.2.3) Lus10030928 25.0 0.8332
AT1G08070 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSIN... Lus10033026 25.7 0.8477

Lus10034504 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.