Lus10034507 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1)
AT5G10990 180 / 5e-59 SAUR-like auxin-responsive protein family (.1)
AT1G19840 170 / 5e-55 SAUR-like auxin-responsive protein family (.1)
AT4G34750 149 / 7e-47 SAUR-like auxin-responsive protein family (.1.2)
AT2G24400 87 / 6e-22 SAUR-like auxin-responsive protein family (.1)
AT4G34760 83 / 2e-21 SAUR-like auxin-responsive protein family (.1)
AT5G20810 84 / 7e-21 SAUR-like auxin-responsive protein family (.1.2)
AT3G43120 82 / 1e-20 SAUR-like auxin-responsive protein family (.1)
AT2G21220 81 / 2e-20 SAUR-like auxin-responsive protein family (.1)
AT4G34770 79 / 6e-20 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033161 291 / 7e-103 AT1G75590 187 / 4e-62 SAUR-like auxin-responsive protein family (.1)
Lus10012426 218 / 9e-74 AT1G75590 181 / 2e-59 SAUR-like auxin-responsive protein family (.1)
Lus10024322 179 / 6e-59 AT1G75590 152 / 3e-48 SAUR-like auxin-responsive protein family (.1)
Lus10012190 136 / 1e-41 AT4G34750 147 / 4e-46 SAUR-like auxin-responsive protein family (.1.2)
Lus10042374 135 / 3e-41 AT5G10990 125 / 8e-38 SAUR-like auxin-responsive protein family (.1)
Lus10026297 134 / 5e-41 AT5G10990 125 / 2e-37 SAUR-like auxin-responsive protein family (.1)
Lus10021130 88 / 3e-23 AT4G34750 97 / 8e-27 SAUR-like auxin-responsive protein family (.1.2)
Lus10017179 86 / 3e-22 AT4G34750 89 / 6e-24 SAUR-like auxin-responsive protein family (.1.2)
Lus10042376 79 / 1e-19 AT4G34770 136 / 3e-43 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G237000 215 / 7e-73 AT1G75590 200 / 4e-67 SAUR-like auxin-responsive protein family (.1)
Potri.002G024500 214 / 1e-72 AT1G75590 194 / 1e-64 SAUR-like auxin-responsive protein family (.1)
Potri.004G164300 170 / 2e-55 AT5G10990 170 / 3e-55 SAUR-like auxin-responsive protein family (.1)
Potri.009G125900 168 / 2e-54 AT5G10990 157 / 5e-50 SAUR-like auxin-responsive protein family (.1)
Potri.009G127400 85 / 4e-22 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1)
Potri.006G126500 84 / 1e-21 AT2G37030 131 / 1e-40 SAUR-like auxin-responsive protein family (.1)
Potri.016G091500 83 / 3e-21 AT2G37030 136 / 2e-42 SAUR-like auxin-responsive protein family (.1)
Potri.018G132400 82 / 2e-20 AT3G43120 64 / 2e-13 SAUR-like auxin-responsive protein family (.1)
Potri.018G063400 82 / 4e-20 AT5G20810 219 / 3e-74 SAUR-like auxin-responsive protein family (.1.2)
Potri.008G037900 80 / 6e-20 AT2G37030 103 / 2e-29 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10034507 pacid=23162843 polypeptide=Lus10034507 locus=Lus10034507.g ID=Lus10034507.BGIv1.0 annot-version=v1.0
ATGTCTGCTGGACTCTCCAAATGCGCCAAAATCCGCCACATTGTGAAGCTTCGCCAAATGCTCCGACGTTGGAGGAACAAGGCAAGGGTATCATCATCAC
TCAACAGGACCACCACCGCCCCTTCCGACGTCCCCTCCGGCCACATCGCCATCTACGTCGGAATCACCTCTCGCCGGTTCGTCGTCCGAGCCACATACCT
CAACCACCCGATTTTTAAGAAACTCCTCACCCAGGCCGAGGAAGAGTACGGATTCTCCAACCAAGGTCCCCTGACCATCCCCTGCGACGAGTCCTTGTTC
GAAGAAGCGATCCGGTACATTTCCAGATCCGAGTCCGGGAAATCCACCACCCGAATCGTCAGCCTGGAGGATCTAGTCAAGAACTGCCGCAACATTGGGA
TCGATTTGTGGACCGACTCCCGGCCGCTTCTCGCGGAGAAAACTATCTGTTGA
AA sequence
>Lus10034507 pacid=23162843 polypeptide=Lus10034507 locus=Lus10034507.g ID=Lus10034507.BGIv1.0 annot-version=v1.0
MSAGLSKCAKIRHIVKLRQMLRRWRNKARVSSSLNRTTTAPSDVPSGHIAIYVGITSRRFVVRATYLNHPIFKKLLTQAEEEYGFSNQGPLTIPCDESLF
EEAIRYISRSESGKSTTRIVSLEDLVKNCRNIGIDLWTDSRPLLAEKTIC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G75590 SAUR-like auxin-responsive pro... Lus10034507 0 1
AT5G14600 S-adenosyl-L-methionine-depend... Lus10032132 17.9 0.8650
AT4G13430 ATLEUC1, IIL1 isopropyl malate isomerase lar... Lus10032620 27.8 0.8776
AT3G22960 PKP-ALPHA, PKP1 PLASTIDIAL PYRUVATE KINASE 1, ... Lus10006633 40.9 0.8657
AT3G14067 Subtilase family protein (.1) Lus10008116 45.4 0.8040
AT3G20660 4-Oct, ATOCT4 organic cation/carnitine trans... Lus10013330 59.9 0.8452
AT2G43870 Pectin lyase-like superfamily ... Lus10002124 69.1 0.8634
AT5G10910 mraW methylase family protein ... Lus10042729 78.8 0.8186
AT4G19710 AK-HSDHII, AK-H... aspartate kinase-homoserine de... Lus10030339 108.6 0.8504
AT3G03420 Ku70-binding family protein (.... Lus10014579 110.7 0.8519
AT2G02360 ATPP2-B10 phloem protein 2-B10 (.1) Lus10003444 140.0 0.8407

Lus10034507 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.