Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G75580 161 / 6e-53 SAUR-like auxin-responsive protein family (.1) AT4G34760 145 / 1e-46 SAUR-like auxin-responsive protein family (.1) AT4G38860 143 / 1e-45 SAUR-like auxin-responsive protein family (.1) AT1G19830 142 / 5e-45 SAUR-like auxin-responsive protein family (.1) AT2G21220 138 / 6e-44 SAUR-like auxin-responsive protein family (.1) AT2G16580 131 / 4e-41 SAUR-like auxin-responsive protein family (.1) AT4G36110 129 / 3e-40 SAUR-like auxin-responsive protein family (.1) AT2G18010 125 / 2e-38 SAUR-like auxin-responsive protein family (.1) AT5G66260 103 / 6e-30 SAUR-like auxin-responsive protein family (.1) AT2G21210 94 / 4e-26 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033159 [exp] 221 / 2e-76 AT1G75580 160 / 1e-52 SAUR-like auxin-responsive protein family (.1) Lus10012432 [exp] 160 / 2e-52 AT1G75580 164 / 9e-54 SAUR-like auxin-responsive protein family (.1) Lus10024326 [exp] 160 / 3e-52 AT1G75580 166 / 2e-54 SAUR-like auxin-responsive protein family (.1) Lus10012189 [exp] 148 / 9e-48 AT4G34760 169 / 3e-56 SAUR-like auxin-responsive protein family (.1) Lus10007553 [exp] 142 / 2e-45 AT4G34760 168 / 9e-56 SAUR-like auxin-responsive protein family (.1) Lus10026296 [exp] 123 / 5e-38 AT4G34760 133 / 4e-42 SAUR-like auxin-responsive protein family (.1) Lus10028466 [exp] 108 / 9e-32 AT4G34760 151 / 5e-49 SAUR-like auxin-responsive protein family (.1) Lus10041921 [exp] 103 / 1e-29 AT4G34760 144 / 7e-46 SAUR-like auxin-responsive protein family (.1) Lus10032173 [exp] 98 / 1e-27 AT4G38840 119 / 3e-36 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G164400 [exp] 158 / 1e-51 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1) Potri.002G024300 [exp] 157 / 2e-51 AT1G75580 170 / 2e-56 SAUR-like auxin-responsive protein family (.1) Potri.009G126000 [exp] 157 / 3e-51 AT4G34760 179 / 4e-60 SAUR-like auxin-responsive protein family (.1) Potri.005G237200 [exp] 154 / 6e-50 AT1G75580 164 / 5e-54 SAUR-like auxin-responsive protein family (.1) Potri.007G012800 [exp] 145 / 8e-47 AT4G34760 164 / 3e-54 SAUR-like auxin-responsive protein family (.1) Potri.009G126700 [exp] 97 / 2e-27 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1) Potri.004G165900 [exp] 95 / 1e-26 AT4G34770 99 / 9e-29 SAUR-like auxin-responsive protein family (.1) Potri.009G127300 [exp] 94 / 1e-26 AT2G21210 104 / 8e-31 SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 94 / 2e-26 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1) Potri.004G165600 [exp] 93 / 6e-26 AT4G34770 118 / 4e-36 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10034511 pacid=23162827 polypeptide=Lus10034511 locus=Lus10034511.g ID=Lus10034511.BGIv1.0 annot-version=v1.0 ATGGGCATCAGAAAGCCAAACAGGCTCCCACAGGCAGCAGCGTTGAAACAGATCCTGAAGAGATGCTCAAGCCTGGGAAAGCGAAGTAGCGATCCTTACG GGTACCACGAGGACGGGGGAGGGATCCTTCTAGACGTACCAAAGGGGCATTTCGTGGTGTACGTTGGCGAGAACAGGAGTAGGTACATTGTCCCGATTTC GTACCTTAGTAGGCCGGAGTTCCAGAGGTTGCTTCGTGAAGCAGAGGAAGAGTTCGGATTTGACCATGACCTCGGTGGCCTCATCATCCCTTGTCAAGAA GTCGTTTTCCAGTCCTTAACTTCTATGCTCTCTTCCTAG
AA sequence Show only first row Show all	>Lus10034511 pacid=23162827 polypeptide=Lus10034511 locus=Lus10034511.g ID=Lus10034511.BGIv1.0 annot-version=v1.0 MGIRKPNRLPQAAALKQILKRCSSLGKRSSDPYGYHEDGGGILLDVPKGHFVVYVGENRSRYIVPISYLSRPEFQRLLREAEEEFGFDHDLGGLIIPCQE VVFQSLTSMLSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G75580			SAUR-like auxin-responsive pro...		Lus10034511 [exp]	0	1
AT1G75580			SAUR-like auxin-responsive pro...		Lus10033159 [exp]	1.0	0.8928
AT3G51895		AST12, ATST1, S...	sulfate transporter 3;1 (.1)		Lus10006612 [exp]	6.5	0.8664
AT3G24220		ATNCED6, NCED6	nine-cis-epoxycarotenoid dioxy...		Lus10023673 [exp]	7.2	0.8675
AT5G06570			alpha/beta-Hydrolases superfam...		Lus10015988 [exp]	11.0	0.8654
AT3G24220		ATNCED6, NCED6	nine-cis-epoxycarotenoid dioxy...		Lus10011750 [exp]	15.0	0.8453
AT3G56970	bHLH	ORG2, bHLH038	OBP3-RESPONSIVE GENE 3, basic ...		Lus10010453 [exp]	18.2	0.8210
					Lus10004996 [exp]	19.0	0.8194
					Lus10003285 [exp]	19.9	0.8194
AT3G61150	HD	HD-GL2-1, HDG1	HOMEODOMAIN-GLABRA2 1, homeodo...		Lus10003300 [exp]	20.8	0.8194
AT2G37890			Mitochondrial substrate carrie...		Lus10006265 [exp]	21.6	0.8194

Compare expression of checked genes

Lus10034511 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.