Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029192 [exp] 171 / 7e-56 ND / Lus10010734 [exp] 170 / 1e-53 AT1G69980 159 / 1e-47 unknown protein Lus10009191 [exp] 162 / 5e-52 ND / Lus10012669 [exp] 153 / 9e-48 ND / Lus10010593 [exp] 136 / 2e-42 ND / Lus10033972 [exp] 132 / 4e-40 AT4G15610 46 / 3e-06 Uncharacterised protein family (UPF0497) (.1) Lus10025380 [exp] 128 / 1e-35 AT3G07610 516 / 8e-170 increase in bonsai methylation 1, Transcription factor jumonji (jmjC) domain-containing protein (.1), Transcription factor jumonji (jmjC) domain-containing protein (.2), Transcription factor jumonji (jmjC) domain-containing protein (.3) Lus10024766 [exp] 117 / 3e-34 ND / Lus10010252 [exp] 119 / 4e-34 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034512 pacid=23162864 polypeptide=Lus10034512 locus=Lus10034512.g ID=Lus10034512.BGIv1.0 annot-version=v1.0 ATGTCTTCAAGTAAGTCCAACGAGAATGTTATGAACAAGTTTTCCCACCCCGATGAGTCAAAGGATTTGTTCACCTACTTTGGAGAAGTGAAGTGCGATT GCGGATTTCGTACAGCGAGACTAATGACGTTGAAGTTCGAGAAGAAGTTGGAGATGGTGTTGGCTGAGAACTCGGTGAAGCGCGAGATGAGAGCTACAAT GGAGGCGAAGCATGGTGAGAAGGATGCTGAGATTGGAGTTGTTCGTGCTGAGCTGGCACATGATCGTTCTGAATGGCAACGTGAGAGGATAGGTATCATA TGGTCAAAGAATAGGTACATTGAGACTCTCACTTAA
AA sequence Show only first row Show all	>Lus10034512 pacid=23162864 polypeptide=Lus10034512 locus=Lus10034512.g ID=Lus10034512.BGIv1.0 annot-version=v1.0 MSSSKSNENVMNKFSHPDESKDLFTYFGEVKCDCGFRTARLMTLKFEKKLEMVLAENSVKREMRATMEAKHGEKDAEIGVVRAELAHDRSEWQRERIGII WSKNRYIETLT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10034512 [exp]	0	1
AT1G12570			Glucose-methanol-choline (GMC)...		Lus10002957 [exp]	3.3	1.0000
AT3G20760			Nse4, component of Smc5/6 DNA ...		Lus10004185 [exp]	4.7	1.0000
					Lus10009800 [exp]	6.6	1.0000
					Lus10010778 [exp]	6.7	1.0000
AT4G01830		ABCB5, PGP5	ATP-binding cassette B5, P-gly...		Lus10004529 [exp]	8.5	1.0000
					Lus10011848 [exp]	9.9	1.0000
AT3G25050		XTH3	xyloglucan endotransglucosylas...		Lus10011845 [exp]	11.0	1.0000
					Lus10022145 [exp]	11.8	1.0000
AT2G28320			Pleckstrin homology (PH) and l...		Lus10023522 [exp]	12.0	1.0000
					Lus10011061 [exp]	12.5	1.0000

Compare expression of checked genes

Lus10034512 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.