Lus10034523 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033147 92 / 8e-25 AT1G75717 41 / 8e-06 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G238400 51 / 1e-08 AT1G75717 52 / 1e-09 unknown protein
PFAM info
Representative CDS sequence
>Lus10034523 pacid=23162763 polypeptide=Lus10034523 locus=Lus10034523.g ID=Lus10034523.BGIv1.0 annot-version=v1.0
ATGCCTCGAAACCAGAGCCTCACTATACAAATACCAGACCTTATTACCAATGAAAGTGGCTACTGCACCACCAAGACCAATATCATTAGCGATACTTCTT
TTCATCGGGAGCCACTAGACGACAAGTTTTGGGCTATGAAGTTGTTCAATCGCTTCCGTAAGGTTCTGGTGCGACTCTTATTCTCCAGTACTACACCTTC
TAGTTATCGCGACGGCGGCGGAGGACGGAACCAAGGGCGGCGTCGTAGTGATGACCGGCATTCTTCGGCGGCGGACCCACCGAAGATATCGTGCAGCAGC
AGCTCAGTGTATAATTACTCGGCTCAGTTGCATTACAGTGAGGCGGTTGCTGATTGCATTGAGTTCTTGAACAAGTCCAGCTCAGCCTCCTCCACGCCTG
CTACTACTACTCACGACGTCGATGATGACGACTTCGTCAGATATTCCGGTTTCGATCAACATCGTCTGAACCAAATCGGTCATGTTTGGGTTTGA
AA sequence
>Lus10034523 pacid=23162763 polypeptide=Lus10034523 locus=Lus10034523.g ID=Lus10034523.BGIv1.0 annot-version=v1.0
MPRNQSLTIQIPDLITNESGYCTTKTNIISDTSFHREPLDDKFWAMKLFNRFRKVLVRLLFSSTTPSSYRDGGGGRNQGRRRSDDRHSSAADPPKISCSS
SSVYNYSAQLHYSEAVADCIEFLNKSSSASSTPATTTHDVDDDDFVRYSGFDQHRLNQIGHVWV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G75717 unknown protein Lus10034523 0 1
AT1G77860 KOM KOMPEITO, Rhomboid-related int... Lus10028036 6.5 0.8354
AT5G09530 PRP10, PELPK1 proline-rich protein 10, Pro-G... Lus10033898 50.0 0.8016
AT2G43870 Pectin lyase-like superfamily ... Lus10002126 53.2 0.7921
Lus10003030 53.5 0.7381
AT2G17080 Arabidopsis protein of unknown... Lus10023954 72.4 0.7488
AT3G62100 AUX_IAA IAA30 indole-3-acetic acid inducible... Lus10038025 74.8 0.7884
AT3G02230 ATRGP1, RGP1 ARABIDOPSIS THALIANA REVERSIBL... Lus10022443 76.8 0.7904
AT5G11590 AP2_ERF DREB3, TINY2 TINY2, Integrase-type DNA-bind... Lus10011123 83.4 0.7861
AT3G09280 unknown protein Lus10021099 102.1 0.7585
AT5G19790 AP2_ERF RAP2.11 related to AP2 11 (.1) Lus10036793 104.2 0.7305

Lus10034523 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.