Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G18420 75 / 9e-19 Gibberellin-regulated family protein (.1) AT4G09600 74 / 2e-18 GASA3 GAST1 protein homolog 3 (.1) AT1G22690 73 / 6e-18 Gibberellin-regulated family protein (.1.2.3) AT1G75750 72 / 7e-18 GASA1 GAST1 protein homolog 1 (.1.2) AT5G14920 63 / 7e-13 Gibberellin-regulated family protein (.1.2) AT4G09610 59 / 9e-13 GASA2 GAST1 protein homolog 2 (.1) AT1G10588 56 / 1e-11 Gibberellin-regulated family protein (.1.2) AT1G74670 56 / 2e-11 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) AT2G39540 54 / 6e-11 Gibberellin-regulated family protein (.1) AT5G15230 52 / 8e-10 GASA4 GAST1 protein homolog 4 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033145 [exp] 154 / 3e-50 AT1G75750 81 / 2e-21 GAST1 protein homolog 1 (.1.2) Lus10017212 [exp] 72 / 9e-18 AT1G75750 107 / 3e-32 GAST1 protein homolog 1 (.1.2) Lus10009421 [exp] 73 / 3e-17 AT1G22690 90 / 1e-23 Gibberellin-regulated family protein (.1.2.3) Lus10014262 [exp] 64 / 4e-14 AT4G09600 86 / 7e-23 GAST1 protein homolog 3 (.1) Lus10025962 [exp] 63 / 6e-14 AT4G09600 87 / 1e-23 GAST1 protein homolog 3 (.1) Lus10039443 [exp] 59 / 1e-11 AT5G14920 103 / 2e-27 Gibberellin-regulated family protein (.1.2) Lus10018708 [exp] 54 / 1e-10 AT5G59845 114 / 8e-35 Gibberellin-regulated family protein (.1) Lus10024338 [exp] 53 / 5e-10 ND 78 / 3e-20 Lus10004048 [exp] 52 / 5e-10 AT1G74670 109 / 1e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G113400 [exp] 87 / 7e-24 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1) Potri.002G022600 [exp] 80 / 9e-21 AT1G75750 110 / 4e-33 GAST1 protein homolog 1 (.1.2) Potri.005G239100 [exp] 80 / 1e-20 AT1G75750 112 / 1e-33 GAST1 protein homolog 1 (.1.2) Potri.005G239000 [exp] 78 / 5e-20 AT2G18420 117 / 6e-36 Gibberellin-regulated family protein (.1) Potri.002G022500 [exp] 78 / 8e-20 AT2G18420 99 / 2e-28 Gibberellin-regulated family protein (.1) Potri.002G022700 [exp] 74 / 2e-18 AT1G75750 94 / 1e-26 GAST1 protein homolog 1 (.1.2) Potri.015G071500 [exp] 73 / 7e-18 AT5G14920 90 / 5e-23 Gibberellin-regulated family protein (.1.2) Potri.012G076700 [exp] 73 / 8e-18 AT2G18420 85 / 9e-23 Gibberellin-regulated family protein (.1) Potri.019G083900 [exp] 67 / 2e-15 AT1G22690 103 / 1e-29 Gibberellin-regulated family protein (.1.2.3) Potri.001G350600 [exp] 65 / 9e-14 AT5G14920 103 / 1e-26 Gibberellin-regulated family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02704 [flax] [poplar] GASA Gibberellin regulated protein
Representative CDS sequence Show only first row Show all	>Lus10034524 pacid=23162888 polypeptide=Lus10034524 locus=Lus10034524.g ID=Lus10034524.BGIv1.0 annot-version=v1.0 ATGGCGACTGGTTTCCGAGTGCCTGCCATTGTTTGCCTTGTCTTCATCCTCATTCCACTTCTCGCCCAACCCCATCAACACATCCCCGCCGACTTCAAGG GCTATGGATTTGCAACTCATGGAAACGACGCCTTTCTTGCAAAAATGAAGTGCGGGGCAGCATGTGCAGGGAGGTGCCGGTTAGCATCGAGGCATCGGAT GTGCATCAGGGCATGCGGGACCTGCTGCGCAAGGTGCAATTGCGTGCCACCGGGCACCTCAGGAAACAGAGAAGTGTGCCCCTGCTACGCCAAGATGACT ACCCACGGCGGGAGGCTCAAGTGTCCTTAA
AA sequence Show only first row Show all	>Lus10034524 pacid=23162888 polypeptide=Lus10034524 locus=Lus10034524.g ID=Lus10034524.BGIv1.0 annot-version=v1.0 MATGFRVPAIVCLVFILIPLLAQPHQHIPADFKGYGFATHGNDAFLAKMKCGAACAGRCRLASRHRMCIRACGTCCARCNCVPPGTSGNREVCPCYAKMT THGGRLKCP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G75750		GASA1	GAST1 protein homolog 1 (.1.2)		Lus10034524 [exp]	0	1
AT3G14880			unknown protein		Lus10013711 [exp]	3.2	0.9986
AT2G38560		RDO2, TFIIS	REDUCED DORMANCY 2, transcript...		Lus10029016 [exp]	4.4	0.9885
AT3G19184	B3		AP2/B3-like transcriptional fa...		Lus10019872 [exp]	5.1	0.9796
AT4G03220			Protein with RNI-like/FBD-like...		Lus10023567 [exp]	5.7	0.9955
AT2G03220		ATFUT1, ATFT1, ...	MURUS 2, ARABIDOPSIS THALIANA ...		Lus10024077 [exp]	6.9	0.9955
AT1G04645			Plant self-incompatibility pro...		Lus10002219 [exp]	8.0	0.9955
					Lus10032670 [exp]	8.0	0.9737
					Lus10009618 [exp]	8.9	0.9955
AT1G75790		SKS18	SKU5 similar 18 (.1)		Lus10013556 [exp]	9.8	0.9955
AT4G28110	MYB	ATMYB41	myb domain protein 41 (.1)		Lus10031607 [exp]	10.2	0.9878

Compare expression of checked genes

Lus10034524 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.