Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G75810 132 / 6e-41 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033134 [exp] 204 / 1e-69 AT1G75810 136 / 9e-43 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G020200 [exp] 157 / 3e-51 AT1G75810 135 / 3e-42 unknown protein Potri.005G241200 [exp] 154 / 4e-50 AT1G75810 140 / 1e-44 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034536 pacid=23162696 polypeptide=Lus10034536 locus=Lus10034536.g ID=Lus10034536.BGIv1.0 annot-version=v1.0 ATGGCGATTTCAGATGCGGTGACTGGAAATTTGACGACGATCTACGTGGCGGTTATAGCCGGGATCAAGGCCTACGGGATGGTATGCGGGCGGCACTTCG GGGCAGGGTTCGTCCTCATGGCTTCCACCACCGTCGTAGGTTTAATCCTTGTCGCCACACTCACCTGGGATGTCTCCCGTAAGGCCACTCACGCCATCAC CCGGGAGCGTACCTGTCGATCGCCTTCACACCACATGTGCAAGGGTGGCATTTGCTGGCATGGCGTCGCCGTCCGATCCCCTGCTTCTCAGGTCCGGTTC AGGCTCCCCCATCATCCGGCTCCTCCTCCGCCGCCGTTCGCCGCCTGGTGA
AA sequence Show only first row Show all	>Lus10034536 pacid=23162696 polypeptide=Lus10034536 locus=Lus10034536.g ID=Lus10034536.BGIv1.0 annot-version=v1.0 MAISDAVTGNLTTIYVAVIAGIKAYGMVCGRHFGAGFVLMASTTVVGLILVATLTWDVSRKATHAITRERTCRSPSHHMCKGGICWHGVAVRSPASQVRF RLPHHPAPPPPPFAAW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G75810			unknown protein		Lus10034536 [exp]	0	1
AT3G07350			Protein of unknown function (D...		Lus10002335 [exp]	2.0	0.9330
AT5G14890			NHL domain-containing protein ...		Lus10032160 [exp]	4.2	0.9293
AT4G38520			Protein phosphatase 2C family ...		Lus10005054 [exp]	8.2	0.9089
AT3G01430			unknown protein		Lus10014527 [exp]	10.1	0.9338
AT5G64530	NAC	ANAC104, XND1	Arabidopsis NAC domain contain...		Lus10010747 [exp]	11.2	0.9239
AT4G21920			unknown protein		Lus10001143 [exp]	15.0	0.9280
AT2G29350		SAG13	senescence-associated gene 13 ...		Lus10024358 [exp]	15.0	0.9197
AT5G47550			Cystatin/monellin superfamily ...		Lus10017567 [exp]	16.9	0.8964
AT3G03050		RHD7, ATCSLD3, ...	ROOT HAIR DEFECTIVE 7, KOJAK, ...		Lus10002134 [exp]	17.3	0.9209
AT5G20950			Glycosyl hydrolase family prot...		Lus10010656 [exp]	18.0	0.9239

Compare expression of checked genes

Lus10034536 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.