Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030781 [exp] 159 / 3e-51 ND / Lus10030780 [exp] 152 / 1e-48 ND 36 / 0.004 Lus10030777 [exp] 151 / 5e-48 AT5G48540 39 / 8e-04 receptor-like protein kinase-related family protein (.1) Lus10013255 [exp] 125 / 6e-38 ND / Lus10013254 [exp] 125 / 9e-38 ND / Lus10034546 [exp] 119 / 1e-35 AT3G22060 43 / 1e-05 Receptor-like protein kinase-related family protein (.1) Lus10035197 [exp] 117 / 4e-35 ND / Lus10013256 [exp] 119 / 6e-35 AT3G21970 39 / 8e-04 Domain of unknown function (DUF26) (.1) Lus10032027 [exp] 115 / 5e-34 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01657 [flax] [poplar] Stress-antifung Salt stress response/antifungal
Representative CDS sequence Show only first row Show all	>Lus10034545 pacid=23162833 polypeptide=Lus10034545 locus=Lus10034545.g ID=Lus10034545.BGIv1.0 annot-version=v1.0 ATGGCAATAACGATGCTTCTCCTGCTTACAGTTACCATTGCGGTTTCTGGCGATGGGTCTTATTGCAGCTCGTCGGGGCCAATAGCATTCGGGCCATGTA AAGACGACTATGGTCTCTGTGTAGCCAACGTGATTACAGTGCTGAGAGACCGTACTCCCTACTCCAATGAGGGGTCATTCACTACGTATTACCCAGCTGA CCAACCATCAGGCGGAGTTGCCGGTCTAGCGGGGTGCGCTCCCGGAATTACCTTCCTTGACTGCCGGAGCTGCCTTATCGTTGCCAAAGACTGGCTAGAC CAGAATTGCGCACCTTTCTCCCGTGGTTATTACTATGGTGCCAATGCGGCTTGCTCCATGACGTACGAGCAAGTATTTGGTTAG
AA sequence Show only first row Show all	>Lus10034545 pacid=23162833 polypeptide=Lus10034545 locus=Lus10034545.g ID=Lus10034545.BGIv1.0 annot-version=v1.0 MAITMLLLLTVTIAVSGDGSYCSSSGPIAFGPCKDDYGLCVANVITVLRDRTPYSNEGSFTTYYPADQPSGGVAGLAGCAPGITFLDCRSCLIVAKDWLD QNCAPFSRGYYYGANAACSMTYEQVFG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10034545 [exp]	0	1
AT4G16195			Plant self-incompatibility pro...		Lus10017929 [exp]	1.4	1.0000
AT5G38435		SPH8	S-protein homologue 8 (.1)		Lus10016168 [exp]	2.0	1.0000
AT5G67090			Subtilisin-like serine endopep...		Lus10002044 [exp]	3.0	1.0000
AT3G08720		ATPK2, ATPK19, ...	ARABIDOPSIS THALIANA SERINE/TH...		Lus10022732 [exp]	3.5	0.8803
AT1G29430			SAUR-like auxin-responsive pro...		Lus10007059 [exp]	3.5	1.0000
AT1G08790			Protein of unknown function (D...		Lus10042536 [exp]	3.9	0.9118
AT1G72125			Major facilitator superfamily ...		Lus10001288 [exp]	4.7	0.8018
AT5G08020		ATRPA70B	ARABIDOPSIS THALIANA RPA70-KDA...		Lus10042979 [exp]	4.9	0.8222
AT1G17615			Disease resistance protein (TI...		Lus10018023 [exp]	5.5	0.8054
AT5G38435		SPH8	S-protein homologue 8 (.1)		Lus10029379 [exp]	5.9	0.8377

Compare expression of checked genes

Lus10034545 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.