Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G76020 57 / 4e-11 Thioredoxin superfamily protein (.1) AT1G20225 48 / 8e-08 Thioredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021843 [exp] 134 / 1e-40 AT1G20225 238 / 1e-79 Thioredoxin superfamily protein (.1) Lus10005616 [exp] 70 / 6e-16 AT1G20225 251 / 9e-85 Thioredoxin superfamily protein (.1) Lus10017254 [exp] 64 / 7e-14 AT1G20225 246 / 1e-82 Thioredoxin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G244400 [exp] 69 / 1e-15 AT1G20225 259 / 1e-87 Thioredoxin superfamily protein (.1) Potri.002G017500 [exp] 58 / 1e-11 AT1G20225 251 / 6e-85 Thioredoxin superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034550 pacid=23162744 polypeptide=Lus10034550 locus=Lus10034550.g ID=Lus10034550.BGIv1.0 annot-version=v1.0 ATGAAGATGATGATGGAGAATAGCCCACATCTCAGTTTTCTCATTGCTCTTTGCTTATTCATCATCTCTAATGGATTGTGTGGCGTTGAATCCCAATCGT TGCCGTCTGCCGAGTACGACGGATTCCTCTACAACAACGGTCCACTCGACCCGAATCCGATTCCGATAGAAGCTTTCTTCGGCCCGGTTTGCCCCGACAG CAGGGATTCATGGGATTTGATGTCTGACCGGTTGTTTGCGGCCGGAATAAATTTAGAACAAGTTCTACAATGA
AA sequence Show only first row Show all	>Lus10034550 pacid=23162744 polypeptide=Lus10034550 locus=Lus10034550.g ID=Lus10034550.BGIv1.0 annot-version=v1.0 MKMMMENSPHLSFLIALCLFIISNGLCGVESQSLPSAEYDGFLYNNGPLDPNPIPIEAFFGPVCPDSRDSWDLMSDRLFAAGINLEQVLQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G76020			Thioredoxin superfamily protei...		Lus10034550 [exp]	0	1
AT5G14380		AGP6	arabinogalactan protein 6 (.1)		Lus10022309 [exp]	36.7	0.4730
AT1G72125			Major facilitator superfamily ...		Lus10001288 [exp]	50.1	0.4797
AT1G35467		RALFL5	RALF-like 5 (.1)		Lus10006213 [exp]	67.8	0.4419
AT1G58060			RNA helicase family protein (....		Lus10012694 [exp]	114.3	0.4278
					Lus10001882 [exp]	154.8	0.3794
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10025913 [exp]	172.3	0.3749

Compare expression of checked genes

Lus10034550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.