Lus10034551 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G42200 113 / 7e-33 RING/U-box superfamily protein (.1)
AT1G53820 72 / 4e-16 RING/U-box superfamily protein (.1)
AT4G40070 72 / 5e-16 RING/U-box superfamily protein (.1)
AT3G16720 71 / 2e-15 ATL2 TOXICOS EN LEVADURA 2 (.1)
AT1G72310 69 / 5e-15 ATL3 RING/U-box superfamily protein (.1)
AT2G42350 68 / 6e-15 RING/U-box superfamily protein (.1)
AT4G09120 68 / 2e-14 RING/U-box superfamily protein (.1)
AT4G35480 67 / 2e-14 RHA3B RING-H2 finger A3B (.1)
AT2G20030 67 / 3e-14 RING/U-box superfamily protein (.1)
AT2G35000 67 / 4e-14 ATL9 Arabidopsis toxicos en levadura 9, RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021842 232 / 1e-80 AT5G42200 103 / 3e-29 RING/U-box superfamily protein (.1)
Lus10017253 161 / 2e-52 AT5G42200 126 / 4e-38 RING/U-box superfamily protein (.1)
Lus10005617 160 / 2e-52 AT5G42200 108 / 6e-31 RING/U-box superfamily protein (.1)
Lus10022743 72 / 1e-16 AT3G10910 154 / 5e-48 RING/U-box superfamily protein (.1)
Lus10021197 71 / 2e-15 AT1G04360 268 / 2e-87 RING/U-box superfamily protein (.1)
Lus10041134 71 / 2e-15 AT1G72200 182 / 3e-54 RING/U-box superfamily protein (.1)
Lus10029178 71 / 3e-15 AT5G40250 297 / 1e-98 RING/U-box superfamily protein (.1)
Lus10036466 71 / 3e-15 AT1G72200 186 / 6e-55 RING/U-box superfamily protein (.1)
Lus10006493 70 / 3e-15 AT3G16720 221 / 5e-71 TOXICOS EN LEVADURA 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G244500 146 / 6e-46 AT5G42200 149 / 3e-46 RING/U-box superfamily protein (.1)
Potri.002G017400 143 / 9e-45 AT5G42200 154 / 2e-48 RING/U-box superfamily protein (.1)
Potri.010G010500 71 / 1e-15 AT3G16720 202 / 1e-63 TOXICOS EN LEVADURA 2 (.1)
Potri.005G036800 71 / 2e-15 AT3G05200 261 / 7e-84 RING/U-box superfamily protein (.1)
Potri.005G255200 67 / 7e-15 AT1G76410 163 / 2e-51 RING/U-box superfamily protein (.1)
Potri.013G025800 69 / 1e-14 AT3G05200 261 / 9e-84 RING/U-box superfamily protein (.1)
Potri.003G073300 68 / 1e-14 AT1G53820 157 / 2e-46 RING/U-box superfamily protein (.1)
Potri.002G101800 68 / 2e-14 AT1G72220 195 / 3e-58 RING/U-box superfamily protein (.1)
Potri.007G111900 68 / 2e-14 AT4G33565 163 / 1e-46 RING/U-box superfamily protein (.1)
Potri.019G130100 66 / 2e-14 AT5G05280 129 / 5e-38 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence
>Lus10034551 pacid=23162768 polypeptide=Lus10034551 locus=Lus10034551.g ID=Lus10034551.BGIv1.0 annot-version=v1.0
ATGAGTGCTCTGTTCGTCGTCTACATTTGCCTCCTCTGGTTCTCTACCAATCCCCCAATCAATCCCGTCGTCGTCGGAAGAGAAGACTTGAAGCCGGTAT
CGAAGAAGGGGCTTTCGGCGGCGGAGCTTGAGAAGCTTCCCAAGGTAACCGGGAAGGATCTCTCGATGGGAAACGAATGTGCGGTTTGCCTGGACGAGAT
CGAGGAGGAACAAACGGCGAGGCGGATTCCGGTCTGTAACCACGGATTTCACGTGGAATGCGCTGATAAGTGGTTGTCGAATAACCCGTTTTGCCCGGTG
TGCCGGGGCAAAATCGACCGAGATCGGCTGAAGAATCCCGGTGGTTACGAAGACAGTCCGTGCTAA
AA sequence
>Lus10034551 pacid=23162768 polypeptide=Lus10034551 locus=Lus10034551.g ID=Lus10034551.BGIv1.0 annot-version=v1.0
MSALFVVYICLLWFSTNPPINPVVVGREDLKPVSKKGLSAAELEKLPKVTGKDLSMGNECAVCLDEIEEEQTARRIPVCNHGFHVECADKWLSNNPFCPV
CRGKIDRDRLKNPGGYEDSPC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G42200 RING/U-box superfamily protein... Lus10034551 0 1
AT4G34120 CBSX2, CDCP1, L... LOSS OF THE TIMING OF ET AND J... Lus10002834 2.6 0.8819
AT4G37680 HHP4 heptahelical protein 4 (.1.2) Lus10011713 8.7 0.8564
AT3G07490 AtCML3, AGD11 calmodulin-like 3, ARF-GAP dom... Lus10009564 9.2 0.8512
AT3G10150 ATPAP16, PAP16 purple acid phosphatase 16 (.1... Lus10031039 10.1 0.8230
AT4G29080 AUX_IAA IAA27, PAP2 indole-3-acetic acid inducible... Lus10034962 12.5 0.8489
AT4G22730 Leucine-rich repeat protein ki... Lus10004333 13.5 0.8446
AT3G60580 C2H2ZnF C2H2-like zinc finger protein ... Lus10004724 14.1 0.8413
Lus10026077 15.1 0.7846
AT2G43060 bHLH AtIBH1, bHLH158 ILI1 binding bHLH 1 (.1) Lus10025511 16.4 0.8476
AT5G42660 Protein of unknown function (D... Lus10024684 17.3 0.8315

Lus10034551 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.