Lus10034553 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007414 53 / 6e-09 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10034553 pacid=23162874 polypeptide=Lus10034553 locus=Lus10034553.g ID=Lus10034553.BGIv1.0 annot-version=v1.0
ATGGACCGTCGGAAGAAAATTTCATCTTATGGTCTAAAATTTCAGTACTTACATGAGTTGAAAACCCTAAGTTTTCCCATTCTATCAGCCGTTTTGTATT
TTGCGAAAGATTCTGGTCCCCCCAAATTCAAGTTCAAGGAAACTAGTTTCACTGCCGATGACAACCAATCAATCGGCGATTGGGACGACAACGGATCCTC
CGCTCGGGTGTTTAGGAGGATACTACTTTCACTGACGACGACGTTTTATCCATCGGCGATTGTTAAGGAGGCGAATCCATCGGCTACGGTGAGTACGACG
AAACTGGTTCTTCCAACAACGGCGAAAAATCCATTGGCTACGGTCCCTGTGATAAATCCACAGGCTGTGGTTCCATCGACGATGAAGAAAGAGGAGGATT
TCAGTGTCTACAAGTGGAATGTCTTTGACGATGCGGACCTTGAAGATGCCTCAAGCAACAACGGAGTGTATGTAATGGACATAATGGAATGA
AA sequence
>Lus10034553 pacid=23162874 polypeptide=Lus10034553 locus=Lus10034553.g ID=Lus10034553.BGIv1.0 annot-version=v1.0
MDRRKKISSYGLKFQYLHELKTLSFPILSAVLYFAKDSGPPKFKFKETSFTADDNQSIGDWDDNGSSARVFRRILLSLTTTFYPSAIVKEANPSATVSTT
KLVLPTTAKNPLATVPVINPQAVVPSTMKKEEDFSVYKWNVFDDADLEDASSNNGVYVMDIME

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10034553 0 1
AT3G18170 Glycosyltransferase family 61 ... Lus10032454 3.3 0.9415
AT5G02910 F-box/RNI-like superfamily pro... Lus10000727 4.7 0.9415
AT2G24370 Protein kinase protein with ad... Lus10027593 5.7 0.9415
Lus10004437 6.6 0.9415
Lus10021739 7.4 0.9415
Lus10039674 8.1 0.9415
AT3G08030 Protein of unknown function, D... Lus10029502 8.8 0.9415
AT1G30700 FAD-binding Berberine family p... Lus10031080 9.4 0.9415
AT2G26490 Transducin/WD40 repeat-like su... Lus10032868 9.9 0.9415
AT1G30920 F-box family protein (.1) Lus10006734 10.5 0.9228

Lus10034553 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.