Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G59000 53 / 1e-09 F-box/RNI-like superfamily protein (.1.2) AT3G42770 53 / 1e-09 F-box/RNI-like/FBD-like domains-containing protein (.1) AT5G56420 51 / 6e-09 F-box/RNI-like/FBD-like domains-containing protein (.1.2) AT5G56690 50 / 7e-09 FBD, F-box and Leucine Rich Repeat domains containing protein (.1) AT3G59170 50 / 1e-08 F-box/RNI-like superfamily protein (.1) AT3G59250 50 / 1e-08 F-box/RNI-like superfamily protein (.1) AT3G18150 50 / 1e-08 RNI-like superfamily protein (.1) AT3G59160 50 / 1e-08 F-box/RNI-like superfamily protein (.1) AT2G04230 49 / 2e-08 FBD, F-box and Leucine Rich Repeat domains containing protein (.1) AT3G59200 49 / 2e-08 F-box/RNI-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021833 [exp] 155 / 4e-49 AT3G42770 54 / 3e-08 F-box/RNI-like/FBD-like domains-containing protein (.1) Lus10025560 [exp] 106 / 5e-30 AT5G22610 53 / 5e-08 F-box/RNI-like/FBD-like domains-containing protein (.1) Lus10027019 [exp] 103 / 7e-29 AT5G22610 53 / 7e-08 F-box/RNI-like/FBD-like domains-containing protein (.1) Lus10025561 [exp] 99 / 8e-27 AT3G49150 52 / 2e-07 F-box/RNI-like superfamily protein (.1) Lus10027020 [exp] 97 / 8e-27 AT1G51370 58 / 6e-10 F-box/RNI-like/FBD-like domains-containing protein (.1.2.3) Lus10015246 [exp] 65 / 6e-14 AT5G44960 44 / 8e-06 F-box/RNI-like/FBD-like domains-containing protein (.1) Lus10034418 [exp] 52 / 2e-09 AT1G13570 148 / 1e-38 F-box/RNI-like superfamily protein (.1) Lus10041818 [exp] 49 / 3e-08 AT1G13570 154 / 3e-42 F-box/RNI-like superfamily protein (.1) Lus10028368 [exp] 47 / 4e-08 AT1G13570 69 / 1e-14 F-box/RNI-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G024600 [exp] 48 / 4e-08 AT4G26350 95 / 9e-21 F-box/RNI-like/FBD-like domains-containing protein (.1) Potri.014G163866 [exp] 47 / 1e-07 AT4G14103 79 / 2e-16 F-box/RNI-like superfamily protein (.1.2) Potri.011G098700 [exp] 45 / 5e-07 AT1G80960 86 / 6e-18 F-box and Leucine Rich Repeat domains containing protein (.1.2.3) Potri.011G121500 [exp] 45 / 1e-06 AT4G14103 142 / 6e-38 F-box/RNI-like superfamily protein (.1.2) Potri.002G132400 [exp] 43 / 3e-06 AT1G13570 251 / 3e-79 F-box/RNI-like superfamily protein (.1) Potri.014G039700 [exp] 43 / 4e-06 AT1G13570 265 / 7e-85 F-box/RNI-like superfamily protein (.1) Potri.017G107600 [exp] 42 / 5e-06 AT1G13570 196 / 4e-58 F-box/RNI-like superfamily protein (.1) Potri.015G002001 [exp] 42 / 6e-06 AT2G04230 59 / 9e-10 FBD, F-box and Leucine Rich Repeat domains containing protein (.1) Potri.011G121400 [exp] 41 / 1e-05 AT1G16930 149 / 9e-40 F-box/RNI-like/FBD-like domains-containing protein (.1) Potri.010G134200 [exp] 40 / 3e-05 AT1G13570 526 / 0.0 F-box/RNI-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0271 [flax] [poplar] F-box PF00646 [flax] [poplar] F-box F-box domain
Representative CDS sequence Show only first row Show all	>Lus10034559 pacid=23162899 polypeptide=Lus10034559 locus=Lus10034559.g ID=Lus10034559.BGIv1.0 annot-version=v1.0 ATGGAGAGGTTACCGGATGAGCTACTCACAGAGATATTACGGTGGATGCCACTGGAGGAAGCCGCAACAACAAGCCTTGTTTCGAAGCGATGGCGATACG CCTGGAGAAACCCACCAAATCCTCAATTCGACGACAACAAGATAACTAAATTCAGGAGCGATGGCTATCCCGTCTCTTACTTCCAAAGCCTCCACGATTT CTACACGTGGATGGACGAGATTATCCGCCATGTGGAATAG
AA sequence Show only first row Show all	>Lus10034559 pacid=23162899 polypeptide=Lus10034559 locus=Lus10034559.g ID=Lus10034559.BGIv1.0 annot-version=v1.0 MERLPDELLTEILRWMPLEEAATTSLVSKRWRYAWRNPPNPQFDDNKITKFRSDGYPVSYFQSLHDFYTWMDEIIRHVE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G59000			F-box/RNI-like superfamily pro...		Lus10034559 [exp]	0	1
AT5G02390		DAU1	DUO1-activated unknown 1, Prot...		Lus10036009 [exp]	2.2	0.8915
AT1G09030	CCAAT	NF-YB4	"nuclear factor Y, subunit B4"...		Lus10004493 [exp]	3.7	0.8032
AT1G76140			Prolyl oligopeptidase family p...		Lus10034558 [exp]	5.3	0.8719
AT5G27740		RFC3, EMB251, E...	replication factor C 3, EMBRYO...		Lus10041764 [exp]	5.7	0.8015
AT1G79840	HD	GL2	GLABRA 2, HD-ZIP IV family of ...		Lus10011440 [exp]	8.2	0.8348
AT2G15220			Plant basic secretory protein ...		Lus10019799 [exp]	9.1	0.7307
AT3G60330		AHA7	H\(+\)-ATPase 7, H\(+\)-ATPase...		Lus10028201 [exp]	11.2	0.8351
AT5G10250		DOT3	DEFECTIVELY ORGANIZED TRIBUTAR...		Lus10026046 [exp]	12.2	0.8291
AT4G17030		ATHEXPBETA3.1, ...	expansin-like B1 (.1)		Lus10001010 [exp]	13.6	0.8320
AT1G06340			Plant Tudor-like protein (.1)		Lus10009266 [exp]	16.4	0.7857

Compare expression of checked genes

Lus10034559 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.