Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G20430 108 / 7e-32 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021831 [exp] 204 / 4e-70 AT1G20430 111 / 4e-33 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G013601 [exp] 127 / 2e-39 AT1G20430 122 / 1e-37 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034561 pacid=23162713 polypeptide=Lus10034561 locus=Lus10034561.g ID=Lus10034561.BGIv1.0 annot-version=v1.0 ATGGCTTCCACCGGCTCAGCAGCTGACGCCCAAAACCCTAGACAAGCTACGGGCTTCCTAGCAAACGCCATCAAGCGGAAACACAGTTTTATCCAGTTTG CCGCGATGACGGGGATCCTGCTTCTCAGCGTTAGATCGCTGGGGCAGAAGTACCGGATCCATGACCTTGAGGATGATACTTCGGCTCTCAAGGAGGAGCA GCTGACGCTCGCTGAACGAATGAAGAACATCAAAGGAGCTTTGTTGCAGGAAGCGTCTCACGAGCCTACCGGCCGATTCGCTACACGCCTTAGCAGTCTC TTCAGCGAGCAAGATTCGAAATAA
AA sequence Show only first row Show all	>Lus10034561 pacid=23162713 polypeptide=Lus10034561 locus=Lus10034561.g ID=Lus10034561.BGIv1.0 annot-version=v1.0 MASTGSAADAQNPRQATGFLANAIKRKHSFIQFAAMTGILLLSVRSLGQKYRIHDLEDDTSALKEEQLTLAERMKNIKGALLQEASHEPTGRFATRLSSL FSEQDSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G20430			unknown protein		Lus10034561 [exp]	0	1
AT3G06610			DNA-binding enhancer protein-r...		Lus10037773 [exp]	1.4	0.8877
AT1G29990		PFD6, PDF6	prefoldin 6 (.1)		Lus10023313 [exp]	2.4	0.8626
AT3G10090			Nucleic acid-binding, OB-fold-...		Lus10029320 [exp]	2.4	0.8631
AT5G60340			P-loop containing nucleoside t...		Lus10016525 [exp]	4.2	0.8273
AT3G27050			unknown protein		Lus10035208 [exp]	8.5	0.8238
AT1G26880			Ribosomal protein L34e superfa...		Lus10042199 [exp]	8.8	0.8375
AT1G32310			unknown protein		Lus10040092 [exp]	9.5	0.8079
AT5G51510			unknown protein		Lus10027200 [exp]	12.0	0.8511
AT2G34520		RPS14	mitochondrial ribosomal protei...		Lus10017877 [exp]	13.5	0.8172
AT2G42680		MBF1A, ATMBF1A	ARABIDOPSIS THALIANA MULTIPROT...		Lus10000056 [exp]	14.0	0.8484

Compare expression of checked genes

Lus10034561 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.