Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G20460 117 / 3e-35 unknown protein AT1G76185 112 / 1e-33 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012282 [exp] 124 / 5e-38 AT1G20460 159 / 2e-52 unknown protein Lus10021826 [exp] 50 / 2e-09 AT1G20460 52 / 2e-10 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G013000 [exp] 123 / 1e-37 AT1G20460 103 / 4e-30 unknown protein Potri.005G248300 [exp] 120 / 1e-36 AT1G20460 101 / 2e-29 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034569 pacid=23162799 polypeptide=Lus10034569 locus=Lus10034569.g ID=Lus10034569.BGIv1.0 annot-version=v1.0 ATGATCACGAGATCGAATCTGGCCGAGCAGTTGAGGGACTACCAGATACGATCCAAGCATGATTGGTCATCCGTTTCCTTCTTCTCCTCCTCCTCTTCCT CCACAAACAACACCTCCAGTCAGTCGAGGGTTGATGTTGTCATATTTGTAATATGGGAACTCGTCATTCTAGCCTTCCTGGTATTTTCAGCGGTATCTTT ATATTTCAGGCATATGCGACTTGCCTTCATCTTAGTATGTGTGACATTACTGTTGGTACTATGCTTGAAAATAACAAAGCATGTGAGGTCAGCGAGGAAG AAGAAACGGAGAATGCTTCTGCCTTTATCCATGTGA
AA sequence Show only first row Show all	>Lus10034569 pacid=23162799 polypeptide=Lus10034569 locus=Lus10034569.g ID=Lus10034569.BGIv1.0 annot-version=v1.0 MITRSNLAEQLRDYQIRSKHDWSSVSFFSSSSSSTNNTSSQSRVDVVIFVIWELVILAFLVFSAVSLYFRHMRLAFILVCVTLLLVLCLKITKHVRSARK KKRRMLLPLSM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G20460			unknown protein		Lus10034569 [exp]	0	1
AT5G05610	Alfin	AL1	alfin-like 1 (.1.2)		Lus10005035 [exp]	4.0	0.6351
AT5G13090			unknown protein		Lus10011343 [exp]	7.5	0.6250
AT5G05610	Alfin	AL1	alfin-like 1 (.1.2)		Lus10027805 [exp]	11.9	0.6308
AT1G71980			Protease-associated (PA) RING/...		Lus10009438 [exp]	24.6	0.6215
AT1G49230			RING/U-box superfamily protein...		Lus10005814 [exp]	26.1	0.6052
AT3G01090		AKIN10, SnRK1.1	SNF1-RELATED PROTEIN KINASE 1....		Lus10036582 [exp]	33.3	0.6131
AT5G18610			Protein kinase superfamily pro...		Lus10036499 [exp]	37.1	0.6194
AT1G10820			Protein of unknown function (D...		Lus10029076 [exp]	37.8	0.5660
AT4G18230			unknown protein		Lus10024587 [exp]	46.9	0.5529
AT1G71980			Protease-associated (PA) RING/...		Lus10000053 [exp]	47.3	0.5869

Compare expression of checked genes

Lus10034569 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.