Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G76190 107 / 2e-31 SAUR-like auxin-responsive protein family (.1) AT1G20470 103 / 1e-29 SAUR-like auxin-responsive protein family (.1) AT4G34780 67 / 2e-15 SAUR-like auxin-responsive protein family (.1) AT4G34750 66 / 1e-14 SAUR-like auxin-responsive protein family (.1.2) AT4G34800 64 / 1e-14 SAUR-like auxin-responsive protein family (.1) AT4G34770 62 / 8e-14 SAUR-like auxin-responsive protein family (.1) AT3G61900 62 / 2e-13 SAUR-like auxin-responsive protein family (.1) AT5G10990 62 / 3e-13 SAUR-like auxin-responsive protein family (.1) AT1G29450 62 / 4e-13 SAUR-like auxin-responsive protein family (.1) AT1G29500 61 / 4e-13 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021825 [exp] 183 / 2e-61 AT1G76190 110 / 1e-32 SAUR-like auxin-responsive protein family (.1) Lus10025114 [exp] 71 / 2e-16 AT1G29450 99 / 4e-27 SAUR-like auxin-responsive protein family (.1) Lus10012185 [exp] 69 / 2e-16 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1) Lus10023970 [exp] 70 / 3e-16 AT1G29450 97 / 2e-26 SAUR-like auxin-responsive protein family (.1) Lus10007560 [exp] 69 / 3e-16 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1) Lus10042376 [exp] 66 / 6e-15 AT4G34770 136 / 3e-43 SAUR-like auxin-responsive protein family (.1) Lus10034507 [exp] 65 / 3e-14 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1) Lus10028466 [exp] 64 / 3e-14 AT4G34760 151 / 5e-49 SAUR-like auxin-responsive protein family (.1) Lus10041921 [exp] 63 / 6e-14 AT4G34760 144 / 7e-46 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G141251 [exp] 75 / 2e-18 AT1G29430 93 / 7e-25 SAUR-like auxin-responsive protein family (.1) Potri.004G181400 [exp] 74 / 1e-17 AT1G29450 132 / 4e-40 SAUR-like auxin-responsive protein family (.1) Potri.017G043400 [exp] 73 / 1e-17 AT5G27780 141 / 8e-44 SAUR-like auxin-responsive protein family (.1) Potri.009G141201 [exp] 72 / 3e-17 AT5G27780 132 / 3e-40 SAUR-like auxin-responsive protein family (.1) Potri.017G043500 [exp] 72 / 3e-17 AT5G27780 120 / 1e-35 SAUR-like auxin-responsive protein family (.1) Potri.002G064300 [exp] 71 / 1e-16 AT1G29510 109 / 2e-31 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Potri.009G140900 [exp] 69 / 4e-16 AT1G29510 139 / 3e-43 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Potri.009G141000 [exp] 69 / 4e-16 AT1G29500 122 / 2e-36 SAUR-like auxin-responsive protein family (.1) Potri.005G196850 [exp] 69 / 2e-15 AT1G29510 102 / 2e-27 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Potri.009G141100 [exp] 67 / 2e-15 AT1G29510 117 / 8e-35 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10034570 pacid=23162705 polypeptide=Lus10034570 locus=Lus10034570.g ID=Lus10034570.BGIv1.0 annot-version=v1.0 ATGCTAAAGCAATGGAGCAGGAAGAAGAAGAACGGCCATTTCGCAGTGTACACAAAAGAAGGCAAGAGGTTCACTGTCCCACTCTGCTACTTGAACCATC CCATCTTCAGAGTCTTGCTGGAGATGGCCGAGGAAGAGTTTGGGACAACGGCTGCCGGCCCCATTCAAGTCCCCTGCGAGGAAGAACTCATGGTCTCCAT TCTTTCTCTGTTGAGAAGAGAAGGAAGCGCTGATGATGATCATGTTTCCTCCTCCATAACCAGCAGCAGCTGTAATGGTGGTTCTTCCTTGGCTGCTATC TTCTTAACCCTTCACTCCCAATTCAGTAGTTAG
AA sequence Show only first row Show all	>Lus10034570 pacid=23162705 polypeptide=Lus10034570 locus=Lus10034570.g ID=Lus10034570.BGIv1.0 annot-version=v1.0 MLKQWSRKKKNGHFAVYTKEGKRFTVPLCYLNHPIFRVLLEMAEEEFGTTAAGPIQVPCEEELMVSILSLLRREGSADDDHVSSSITSSSCNGGSSLAAI FLTLHSQFSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G76190			SAUR-like auxin-responsive pro...		Lus10034570 [exp]	0	1
AT2G41310		ARR8, ATRR3	RESPONSE REGULATOR 8, response...		Lus10007885 [exp]	3.9	0.9000
AT4G32890	GATA	GATA9	GATA transcription factor 9 (....		Lus10038273 [exp]	3.9	0.8869
AT5G38970		ATBR6OX, CYP85A...	brassinosteroid-6-oxidase 1 (....		Lus10005075 [exp]	8.5	0.8702
AT2G26700		PID2	PINOID2, AGC (cAMP-dependent, ...		Lus10013715 [exp]	8.9	0.8961
AT1G76880	Trihelix		Duplicated homeodomain-like su...		Lus10028582 [exp]	10.6	0.8816
AT3G62980		AtTIR1, TIR1	TRANSPORT INHIBITOR RESPONSE 1...		Lus10011262 [exp]	15.3	0.8544
AT4G32890	GATA	GATA9	GATA transcription factor 9 (....		Lus10025829 [exp]	19.1	0.8810
AT5G07720			Galactosyl transferase GMA12/M...		Lus10015721 [exp]	22.6	0.8563
AT2G45050	GATA	GATA2	GATA transcription factor 2 (....		Lus10042879 [exp]	23.6	0.7987
AT1G75240	ZF_HD	ATHB33, ZHD5	zinc-finger homeodomain 5, hom...		Lus10031315 [exp]	26.5	0.8692

Compare expression of checked genes

Lus10034570 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.