Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G76200 94 / 3e-27 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016001 [exp] 101 / 2e-30 AT1G76200 91 / 2e-26 unknown protein Lus10012279 [exp] 90 / 2e-24 AT1G76200 79 / 1e-19 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G012700 [exp] 108 / 2e-33 AT1G76200 91 / 2e-26 unknown protein Potri.005G248600 [exp] 108 / 3e-33 AT1G76200 91 / 3e-26 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034571 pacid=23162820 polypeptide=Lus10034571 locus=Lus10034571.g ID=Lus10034571.BGIv1.0 annot-version=v1.0 ATGGCGGGAGGAGGGCACGGCGATGGCATCACTTACAAGGGTCTGACCATGCACAAGCCCAAGCGGTGGCACACAGTCACCGGAAAGGGTCTTTGTGCAG TCATGTGGTTTTGGGTACTTTACAGGGCAAAACAGGACGGTCCTGTTGTGTTGGGCTGGAGACATCCATGGGACGGCCATGGAGATGATCATGATCATGG ACACTAG
AA sequence Show only first row Show all	>Lus10034571 pacid=23162820 polypeptide=Lus10034571 locus=Lus10034571.g ID=Lus10034571.BGIv1.0 annot-version=v1.0 MAGGGHGDGITYKGLTMHKPKRWHTVTGKGLCAVMWFWVLYRAKQDGPVVLGWRHPWDGHGDDHDHGH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G76200			unknown protein		Lus10034571 [exp]	0	1
AT1G74940			Protein of unknown function (D...		Lus10027642 [exp]	1.4	0.8721
AT4G08980		FBW2	F-BOX WITH WD-40 2 (.1.2.3.4.5...		Lus10010351 [exp]	2.8	0.8294
AT2G28910		CXIP4	CAX interacting protein 4 (.1)		Lus10005458 [exp]	3.3	0.8742
AT2G36320			A20/AN1-like zinc finger famil...		Lus10035603 [exp]	3.7	0.8406
AT4G34700		CIB22, AtCIB22	B22 subunit of eukaryotic mito...		Lus10018052 [exp]	6.7	0.8513
AT2G40095			Alpha/beta hydrolase related p...		Lus10014849 [exp]	7.7	0.8202
AT4G30660			Low temperature and salt respo...		Lus10035809 [exp]	8.5	0.8023
AT3G57450			unknown protein		Lus10018070 [exp]	8.8	0.8202
AT3G56190		ASNAP, ALPHA-SN...	alpha-soluble NSF attachment p...		Lus10032835 [exp]	10.0	0.8264
AT5G50460			secE/sec61-gamma protein trans...		Lus10041552 [exp]	11.5	0.8083

Compare expression of checked genes

Lus10034571 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.