Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G42290 39 / 0.0001 transcription activator-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021820 [exp] 117 / 9e-36 AT5G42290 74 / 2e-18 transcription activator-related (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034574 pacid=23162919 polypeptide=Lus10034574 locus=Lus10034574.g ID=Lus10034574.BGIv1.0 annot-version=v1.0 ATGGAGAAACGAGATGGCGGGGAGGAGCGAGGGAAGAGCGAAGAGACGAATCCGAATGTGAATCAAATGACGGAGATGAAGCCAGTGACTAAGGAAGCAT ATGGCCGTGGAATGTACGCAAACGAAAACAATGACAAAACACAACATCAGGGACATCAGCAGCAGCAGCAGCGGGCAAGCGATACGCAGAGTGCCGACGG TCCGGTAGAGGAGTCAAGGGAGCTGAAGCATCCTCCACCGCCGGAAGCATCCGCCGCCGCCGTCCACTGGGGATCGGGACTTGGATATAACCGGCATGTC TTACATCGAGTAGATGATGCCCTGCTGTTTTATGTCTTATAA
AA sequence Show only first row Show all	>Lus10034574 pacid=23162919 polypeptide=Lus10034574 locus=Lus10034574.g ID=Lus10034574.BGIv1.0 annot-version=v1.0 MEKRDGGEERGKSEETNPNVNQMTEMKPVTKEAYGRGMYANENNDKTQHQGHQQQQQRASDTQSADGPVEESRELKHPPPPEASAAAVHWGSGLGYNRHV LHRVDDALLFYVL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G42290			transcription activator-relate...		Lus10034574 [exp]	0	1
AT4G27280			Calcium-binding EF-hand family...		Lus10018511 [exp]	6.3	0.8253
AT1G35470			SPla/RYanodine receptor (SPRY)...		Lus10006084 [exp]	17.7	0.8252
AT1G11755		LEW1	LEAF WILTING 1, Undecaprenyl p...		Lus10026330 [exp]	18.4	0.7840
AT1G71150			unknown protein		Lus10007946 [exp]	19.5	0.7893
AT5G19440			NAD(P)-binding Rossmann-fold s...		Lus10008669 [exp]	21.5	0.8158
AT5G03250			Phototropic-responsive NPH3 fa...		Lus10013799 [exp]	23.3	0.8104
AT5G17680			disease resistance protein (TI...		Lus10010221 [exp]	24.2	0.8018
AT3G11620		BAS1	alpha/beta-Hydrolases superfam...		Lus10016976 [exp]	30.6	0.7549
AT5G45190			Cyclin family protein (.1.2)		Lus10018272 [exp]	31.6	0.7945
AT1G14790		ATRDRP1, RDR1	RNA-dependent RNA polymerase 1...		Lus10034391 [exp]	32.2	0.7856

Compare expression of checked genes

Lus10034574 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.