Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G70790 182 / 2e-59 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2) AT1G70810 180 / 6e-59 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT2G01540 174 / 3e-56 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT1G70800 172 / 1e-55 EHB1 ENHANCED BENDING 1, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT1G48590 168 / 4e-54 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2), Calcium-dependent lipid-binding (CaLB domain) family protein (.3) AT3G17980 163 / 5e-52 AtC2 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT5G37740 161 / 1e-51 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2) AT1G23140 153 / 3e-48 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT1G73580 151 / 1e-47 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT1G66360 146 / 2e-45 Calcium-dependent lipid-binding (CaLB domain) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021775 [exp] 270 / 6e-94 AT1G70810 209 / 6e-70 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10003710 [exp] 196 / 1e-65 AT1G48590 158 / 2e-50 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2), Calcium-dependent lipid-binding (CaLB domain) family protein (.3) Lus10001594 [exp] 196 / 1e-64 AT3G17980 187 / 7e-61 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10009684 [exp] 168 / 4e-53 AT3G17980 254 / 1e-86 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10009053 [exp] 163 / 4e-51 AT3G17980 255 / 1e-86 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10033585 [exp] 150 / 3e-47 AT3G17980 244 / 1e-83 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10042002 [exp] 150 / 6e-47 AT1G48590 240 / 6e-82 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2), Calcium-dependent lipid-binding (CaLB domain) family protein (.3) Lus10017629 [exp] 148 / 3e-46 AT3G17980 241 / 2e-82 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10018005 [exp] 145 / 9e-45 AT3G17980 222 / 1e-74 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G131500 [exp] 198 / 5e-66 AT3G17980 202 / 5e-67 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.010G110900 [exp] 198 / 7e-66 AT1G70790 233 / 3e-79 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2) Potri.017G125500 [exp] 176 / 2e-57 AT3G17980 249 / 6e-86 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.004G089500 [exp] 170 / 7e-55 AT3G17980 245 / 4e-84 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.012G047100 [exp] 160 / 3e-51 AT3G17980 251 / 2e-86 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.001G372000 [exp] 102 / 8e-27 AT4G21160 506 / 0.0 ARF-GAP domain 12, Calcium-dependent ARF-type GTPase activating protein family (.1.2.3.4) Potri.011G098500 [exp] 101 / 2e-26 AT4G21160 506 / 0.0 ARF-GAP domain 12, Calcium-dependent ARF-type GTPase activating protein family (.1.2.3.4) Potri.006G004600 [exp] 96 / 9e-26 AT5G47710 270 / 3e-94 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2) Potri.003G198301 [exp] 93 / 1e-22 AT3G07940 503 / 7e-178 Calcium-dependent ARF-type GTPase activating protein family (.1) Potri.T125706 [exp] 93 / 1e-22 AT3G07940 503 / 8e-178 Calcium-dependent ARF-type GTPase activating protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0154 [flax] [poplar] C2 PF00168 [flax] [poplar] C2 C2 domain
Representative CDS sequence Show only first row Show all	>Lus10034591 pacid=23162735 polypeptide=Lus10034591 locus=Lus10034591.g ID=Lus10034591.BGIv1.0 annot-version=v1.0 ATGCAGAAGTTGAAAACCAAAGTGGTGAAGAACAACTGCAACCCAGAATGGAACGAAGAGCTCACCCTTTCCATTAGGGACACCAATTTCCCCATCCTAC TCACGGTTTACGACAAGGACACACTAACAGCGGACGACAAGATGGGAGAGGTAAACATAGACATACGGCCTTTTGTAGCAGCACACAAGATGGGACTCCA CAACCTCCCCAAAGGGTGCACCATTAAGAGGATTCAGCCGACACGAGAGAACTGTCTCGCTGAGGAAAGCGCTATTACTTGGAACGAAGGCAAGATCCTT CAGGACATGGTTATGAAGCTGCAGAATGTGGAGTCCGGCGAGATCCACATTCAGCTGGAGTGGATTAATATTCCTGGTTGCAAAGGGATTACCGAGAACA AAGGAGGCGAATCCAGCTCGGAATCGAAGATCAGATACACCCTCTAG
AA sequence Show only first row Show all	>Lus10034591 pacid=23162735 polypeptide=Lus10034591 locus=Lus10034591.g ID=Lus10034591.BGIv1.0 annot-version=v1.0 MQKLKTKVVKNNCNPEWNEELTLSIRDTNFPILLTVYDKDTLTADDKMGEVNIDIRPFVAAHKMGLHNLPKGCTIKRIQPTRENCLAEESAITWNEGKIL QDMVMKLQNVESGEIHIQLEWINIPGCKGITENKGGESSSESKIRYTL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G70790			Calcium-dependent lipid-bindin...		Lus10034591 [exp]	0	1
AT3G54140		ATPTR1	ARABIDOPSIS THALIANA PEPTIDE T...		Lus10021132 [exp]	6.6	0.8171
AT5G49180			Plant invertase/pectin methyle...		Lus10003968 [exp]	7.7	0.7815
AT2G32350			Ubiquitin-like superfamily pro...		Lus10039679 [exp]	17.1	0.8080
AT3G18010	HD	WOX1	WUSCHEL related homeobox 1 (.1...		Lus10042007 [exp]	18.4	0.8155
AT3G18010	HD	WOX1	WUSCHEL related homeobox 1 (.1...		Lus10018011 [exp]	19.4	0.8100
AT4G39490		CYP96A10	"cytochrome P450, family 96, s...		Lus10002525 [exp]	22.9	0.8122
					Lus10006297 [exp]	22.9	0.7288
AT5G03790	HD	LMI1, ATHB51	LATE MERISTEM IDENTITY1, homeo...		Lus10035583 [exp]	23.4	0.8109
AT5G19650	OFP	ATOFP8, OFP8	ovate family protein 8 (.1)		Lus10011092 [exp]	27.9	0.7918
AT3G49950	GRAS		GRAS family transcription fact...		Lus10039709 [exp]	31.9	0.7972

Compare expression of checked genes

Lus10034591 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.