Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G23220 181 / 4e-60 Dynein light chain type 1 family protein (.1) AT5G20110 128 / 4e-38 Dynein light chain type 1 family protein (.1) AT3G16120 81 / 7e-21 Dynein light chain type 1 family protein (.1) AT1G52240 81 / 1e-20 PIRF1, ATROPGEF11, ROPGEF11 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) AT4G15930 77 / 5e-19 Dynein light chain type 1 family protein (.1) AT4G27360 76 / 1e-18 Dynein light chain type 1 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021793 [exp] 241 / 2e-83 AT1G23220 176 / 6e-58 Dynein light chain type 1 family protein (.1) Lus10030069 [exp] 113 / 5e-32 AT5G20110 201 / 2e-65 Dynein light chain type 1 family protein (.1) Lus10014484 [exp] 112 / 1e-31 AT5G20110 191 / 2e-61 Dynein light chain type 1 family protein (.1) Lus10031734 [exp] 106 / 8e-31 AT1G23220 100 / 6e-29 Dynein light chain type 1 family protein (.1) Lus10004252 [exp] 107 / 5e-28 AT1G69960 538 / 0.0 serine/threonine protein phosphatase 2A (.1) Lus10025794 [exp] 85 / 2e-22 AT1G52240 172 / 1e-57 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10035868 [exp] 82 / 2e-21 AT1G52240 174 / 2e-58 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10022596 [exp] 74 / 5e-18 AT1G52240 113 / 5e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10021496 [exp] 74 / 6e-18 AT1G52240 114 / 2e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G108700 [exp] 202 / 3e-68 AT1G23220 187 / 2e-62 Dynein light chain type 1 family protein (.1) Potri.008G133000 [exp] 201 / 3e-68 AT1G23220 204 / 3e-69 Dynein light chain type 1 family protein (.1) Potri.011G120400 [exp] 121 / 8e-36 AT1G23220 112 / 1e-32 Dynein light chain type 1 family protein (.1) Potri.001G124700 [exp] 117 / 3e-34 AT5G20110 116 / 3e-33 Dynein light chain type 1 family protein (.1) Potri.001G401400 [exp] 116 / 4e-34 AT1G23220 109 / 2e-31 Dynein light chain type 1 family protein (.1) Potri.015G067800 [exp] 117 / 1e-32 AT5G20110 142 / 3e-41 Dynein light chain type 1 family protein (.1) Potri.003G108700 [exp] 108 / 7e-31 AT5G20110 116 / 4e-33 Dynein light chain type 1 family protein (.1) Potri.003G052800 [exp] 80 / 2e-20 AT1G52240 151 / 3e-49 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Potri.008G219900 [exp] 78 / 2e-19 AT4G15930 154 / 1e-49 Dynein light chain type 1 family protein (.1) Potri.001G407900 [exp] 76 / 1e-18 AT4G27360 126 / 5e-39 Dynein light chain type 1 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01221 [flax] [poplar] Dynein_light Dynein light chain type 1
Representative CDS sequence Show only first row Show all	>Lus10034609 pacid=23162759 polypeptide=Lus10034609 locus=Lus10034609.g ID=Lus10034609.BGIv1.0 annot-version=v1.0 ATGATGGACGATGCACAGCTGGAACTGGAGAGGAGGAGCAAGTTCTTGAGCAGCTTGATCCAGAAACAGAAAGCAGCCAACACTCACCAAGACAGCCAGC CGGAAGGGTTTAATGTGAAAGTTAGAGCTTCTGATATGCCCATTGCTCTCCAGACAAAGGCATTCACTTGTGCTCGTCACCAGCTCGACTCCATGCCTCC CAAGAAGCTTGACAGTAAGCAACTTGCACTCGCCCTCAAAAAGGAATTTGACTCTGCGTACGGTCCAGCTTGGCATTGCATAGTTGGGACAAGCTTTGGT TCATATGTCACACATTCAATAGGAGGCTTTCTCTACTTCTCCATCGACAAGCTTTTCGTTCTCCTCTTCAAGACTGCCGTTGAGCCTTTTGATCGCTCCC TCTGA
AA sequence Show only first row Show all	>Lus10034609 pacid=23162759 polypeptide=Lus10034609 locus=Lus10034609.g ID=Lus10034609.BGIv1.0 annot-version=v1.0 MMDDAQLELERRSKFLSSLIQKQKAANTHQDSQPEGFNVKVRASDMPIALQTKAFTCARHQLDSMPPKKLDSKQLALALKKEFDSAYGPAWHCIVGTSFG SYVTHSIGGFLYFSIDKLFVLLFKTAVEPFDRSL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G23220			Dynein light chain type 1 fami...		Lus10034609 [exp]	0	1
AT2G34710	HD	ATHB14, PHB-1D,...	PHABULOSA 1D, PHABULOSA, ARABI...		Lus10023357 [exp]	8.7	0.8110
AT5G57100			Nucleotide/sugar transporter f...		Lus10020017 [exp]	10.3	0.8373
AT5G52870		MAKR5	MEMBRANE-ASSOCIATED KINASE REG...		Lus10039306 [exp]	11.6	0.8286
AT1G43190		PTB3	polypyrimidine tract-binding p...		Lus10028566 [exp]	12.0	0.7669
AT5G48520		AtAUG3	augmin 3, unknown protein		Lus10025869 [exp]	17.0	0.7795
AT2G28070		ABCG3	ATP-binding cassette G3, ABC-2...		Lus10037384 [exp]	17.2	0.7780
AT3G57070			Glutaredoxin family protein (....		Lus10042021 [exp]	17.5	0.8141
AT1G17820			Putative integral membrane pro...		Lus10036188 [exp]	21.1	0.7963
AT5G43810		PNH, ZLL, AGO10	ZWILLE, PINHEAD, ARGONAUTE 10,...		Lus10006627 [exp]	26.9	0.7887
AT4G35785			RNA-binding (RRM/RBD/RNP motif...		Lus10017507 [exp]	29.9	0.7574

Compare expression of checked genes

Lus10034609 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.