Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G13240 110 / 2e-31 transcription regulators (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007961 [exp] 144 / 7e-43 AT5G13240 260 / 2e-86 transcription regulators (.1) Lus10013491 [exp] 143 / 2e-41 AT5G13240 299 / 1e-99 transcription regulators (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G115800 [exp] 144 / 2e-44 AT5G13240 335 / 4e-118 transcription regulators (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF09174 [flax] [poplar] Maf1 Maf1 regulator
Representative CDS sequence Show only first row Show all	>Lus10034638 pacid=23162866 polypeptide=Lus10034638 locus=Lus10034638.g ID=Lus10034638.BGIv1.0 annot-version=v1.0 ATGCGAACGAGAAGTGCATTTTTGTTTCTCTTGGAGTGGATAGAGGAAAATGATGGTACTTCCTTACTGGATACAATATACAAGGCTCTTGACGAGGTTG TAGATCTATCTGACTGTGAAATTTACAGTTACGATCCTGACTCTGATGCAAACCCACTTCTGGAGGAGGGTGCAATCTGGTCTTTTAGCTTCTTCTTCTA TAACAGAAAGCTAAAGAGGGTTGTAAGCCTCTGTTTATGCTCCATAAGTAACTTCATGGGCGTAGGTAACCTGAGTGGTGACGAGGAAGATGGAGAAATT TTCGATGACATGGACATACAACATCGGTTATCTCTAGATAGGCAACTCCTAAGATGTTCATAA
AA sequence Show only first row Show all	>Lus10034638 pacid=23162866 polypeptide=Lus10034638 locus=Lus10034638.g ID=Lus10034638.BGIv1.0 annot-version=v1.0 MRTRSAFLFLLEWIEENDGTSLLDTIYKALDEVVDLSDCEIYSYDPDSDANPLLEEGAIWSFSFFFYNRKLKRVVSLCLCSISNFMGVGNLSGDEEDGEI FDDMDIQHRLSLDRQLLRCS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G13240			transcription regulators (.1)		Lus10034638 [exp]	0	1
AT1G17960			Threonyl-tRNA synthetase (.1)		Lus10030644 [exp]	2.0	0.9744
					Lus10010397 [exp]	2.8	0.9743
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10006244 [exp]	4.2	0.9710
AT5G47180			Plant VAMP (vesicle-associated...		Lus10000591 [exp]	10.8	0.8741
AT4G27390			unknown protein		Lus10037884 [exp]	16.1	0.9678
AT3G09280			unknown protein		Lus10018504 [exp]	17.9	0.9290
					Lus10024550 [exp]	18.3	0.9652
AT5G18470			Curculin-like (mannose-binding...		Lus10003099 [exp]	18.4	0.9648
AT2G20420			ATP citrate lyase (ACL) family...		Lus10024923 [exp]	20.0	0.9652
AT5G24860		ATFPF1, FPF1	ARABIDOPSIS FLOWERING PROMOTIN...		Lus10026956 [exp]	20.6	0.8857

Compare expression of checked genes

Lus10034638 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.