Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G04025 40 / 3e-05 RGF3 root meristem growth factor 3, unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019202 [exp] 37 / 0.0004 AT1G13620 44 / 4e-06 root meristem growth factor 2, unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G112400 [exp] 37 / 0.0007 AT2G04025 42 / 1e-05 root meristem growth factor 3, unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034649 pacid=23162855 polypeptide=Lus10034649 locus=Lus10034649.g ID=Lus10034649.BGIv1.0 annot-version=v1.0 ATGGTGTCCCATTCAACACAACTACGTGCCTTCCTTCTCCTACTAATCATCATTACCACCACCTGCCTCCTCCATCATGTGGAGGCAAATGATCAGGTAG CTGTTGATGGCATTGTGAAAACTAAGTGCAGAGATAAGGTGGCAATTGGAGGAAGGAAAGTGATGGAGCAATCAAATGAACAAGACCAATCAAGTGATGA GAAAACAGTGCAAAAGGGCAACAACAACAGCAAAGTGGTTGACTTTACGGCGGATTACCATCTCCCTAAATCACACCCTCCTAAGCACAATTGA
AA sequence Show only first row Show all	>Lus10034649 pacid=23162855 polypeptide=Lus10034649 locus=Lus10034649.g ID=Lus10034649.BGIv1.0 annot-version=v1.0 MVSHSTQLRAFLLLLIIITTTCLLHHVEANDQVAVDGIVKTKCRDKVAIGGRKVMEQSNEQDQSSDEKTVQKGNNNSKVVDFTADYHLPKSHPPKHN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10034649 [exp]	0	1
AT1G04610		YUC3	YUCCA 3 (.1)		Lus10023695 [exp]	3.2	0.9199
AT2G24400			SAUR-like auxin-responsive pro...		Lus10035716 [exp]	9.4	0.9203
AT2G17080			Arabidopsis protein of unknown...		Lus10023964 [exp]	12.7	0.9115
AT5G14920			Gibberellin-regulated family p...		Lus10032168 [exp]	15.0	0.9113
AT1G02205		CER1	ECERIFERUM 1, Fatty acid hydro...		Lus10023109 [exp]	16.9	0.8877
AT2G12646			PLATZ transcription factor fam...		Lus10008814 [exp]	20.0	0.9079
AT2G17080			Arabidopsis protein of unknown...		Lus10014450 [exp]	21.2	0.9026
AT3G08030			Protein of unknown function, D...		Lus10016393 [exp]	31.4	0.9062
AT1G51190	AP2_ERF	PLT2	PLETHORA 2, Integrase-type DNA...		Lus10031260 [exp]	31.5	0.8888
AT2G17080			Arabidopsis protein of unknown...		Lus10025126 [exp]	33.1	0.8959

Compare expression of checked genes

Lus10034649 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.