Lus10034655 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G08100 459 / 4e-164 ASPGA1 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
AT3G16150 328 / 4e-112 ASPGB1 asparaginase B1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
AT4G00590 83 / 1e-17 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
AT5G61540 82 / 2e-17 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034668 582 / 0 AT5G08100 489 / 6e-176 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Lus10024795 309 / 2e-104 AT3G16150 536 / 0.0 asparaginase B1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Lus10017879 142 / 1e-41 AT5G08100 157 / 4e-48 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Lus10009826 87 / 7e-19 AT4G00590 446 / 2e-156 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Lus10040935 86 / 1e-18 AT4G00590 484 / 8e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Lus10009560 83 / 1e-17 AT5G61540 518 / 0.0 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Lus10020385 81 / 2e-16 AT5G61540 429 / 1e-147 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G063400 486 / 1e-174 AT5G08100 485 / 2e-174 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Potri.002G122900 333 / 4e-114 AT3G16150 540 / 0.0 asparaginase B1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Potri.014G022900 327 / 2e-111 AT3G16150 556 / 0.0 asparaginase B1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Potri.014G080600 83 / 1e-17 AT4G00590 486 / 1e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Potri.014G191900 76 / 2e-15 AT5G61540 497 / 2e-177 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0052 NTN PF01112 Asparaginase_2 Asparaginase
Representative CDS sequence
>Lus10034655 pacid=23162736 polypeptide=Lus10034655 locus=Lus10034655.g ID=Lus10034655.BGIv1.0 annot-version=v1.0
ATGGGTTGGGCAATCGCTCTCCACGGCGGCGCCGGTGACATACCACTCTCCCTTCCACCCGACCGCCGTCTCCCCCGCGAAGCCGCTCTCCGCCACTGCC
TCCAGCTCGGCGTCTCCGCTCTTCAGTCCAACTCCCACCCTCTTGACGTCGTCGAGCTCGTCGTTCGTGAATTGGAGAACCACCCACAGTTCAATGCGGG
TAAGGGATCTGTACTAAGCACTGCTGGGACAGTGGAGATGGAAGCTAGCATCATGGATGGCAAAACAAAGAACTGTGGAGCAGTTTCTGGACTTACCACT
GTTGTCAACGCTATCTCACTAGCACGCCTCGTCATGGATAAAACGCCTCATATCTATCTGGGGTTCCAAGGAGCTGAAGCTTTTGCAAGGGAACAAGGTG
TAGAGACAGTTGATCCAAGTCATTTCATTACTCCCGAAAATATCGAGAGGCTGAAGCAGGCCAAAGAAGCTAACAGAGTCCAGATTGACTACACACAACC
GATCAAGGAAGGCGAGAAGCATGATCAAACCGTGGCTGTCAACAGTAGCGGGGACAGCCAAATCGGAACAGTTGGATGCGTGGCAGTCGACAACGAAGGG
AACTTAGCATCTGCAACTTCTACAGGCGGACTAGTTAATAAGATGGTGGGGAGGATCGGCGACACACCTGTGATAGGTGCAGGGACATACGCAAACAGTT
ACTGTGCAGTTTCGGCCACGGGGCAAGGAGAATTTGTCATACGTGCTACTGCTGCTAGAGAAGTTGCTGCTCTTATGGAATACAAGGGTCTCTCTCTCAA
GGAAGCTGCTGCTTATGTGGTTGATAAGTGTGCTCCTAAAGGCACTGTTGGATTGATCGCTGTGTCTGCTACAGGGGAAGTCACAATGCCGTTCAACACG
ACTGGGATGTTTCGAGCATGTGCTACAGAAGAAGGCTACTCCGAAATCGGGATATGGCATGACGAGCAAGAGTGA
AA sequence
>Lus10034655 pacid=23162736 polypeptide=Lus10034655 locus=Lus10034655.g ID=Lus10034655.BGIv1.0 annot-version=v1.0
MGWAIALHGGAGDIPLSLPPDRRLPREAALRHCLQLGVSALQSNSHPLDVVELVVRELENHPQFNAGKGSVLSTAGTVEMEASIMDGKTKNCGAVSGLTT
VVNAISLARLVMDKTPHIYLGFQGAEAFAREQGVETVDPSHFITPENIERLKQAKEANRVQIDYTQPIKEGEKHDQTVAVNSSGDSQIGTVGCVAVDNEG
NLASATSTGGLVNKMVGRIGDTPVIGAGTYANSYCAVSATGQGEFVIRATAAREVAALMEYKGLSLKEAAAYVVDKCAPKGTVGLIAVSATGEVTMPFNT
TGMFRACATEEGYSEIGIWHDEQE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G08100 ASPGA1 asparaginase A1, N-terminal nu... Lus10034655 0 1
AT1G01430 TBL25 TRICHOME BIREFRINGENCE-LIKE 25... Lus10005952 2.2 0.8475
AT4G04860 DER2.2 DERLIN-2.2 (.1) Lus10020053 5.1 0.8245
AT5G11090 serine-rich protein-related (.... Lus10001928 6.5 0.7877
AT5G65380 MATE efflux family protein (.1... Lus10015903 7.7 0.7975
AT2G34980 SETH1 phosphatidylinositolglycan syn... Lus10024198 8.9 0.7625
AT1G60940 SNRK2-10, SNRK2... SNF1-RELATED KINASE 2B, SUCROS... Lus10015464 12.0 0.7785
AT5G62610 bHLH bHLH079 basic helix-loop-helix (bHLH) ... Lus10033120 16.0 0.7160
AT1G01430 TBL25 TRICHOME BIREFRINGENCE-LIKE 25... Lus10029454 19.0 0.8107
AT5G02040 PRA1.A1 prenylated RAB acceptor 1.A1 (... Lus10021492 19.1 0.7398
AT3G55530 SDIR1 SALT- AND DROUGHT-INDUCED RING... Lus10000513 19.4 0.7649

Lus10034655 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.