Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G34520 129 / 9e-40 RPS14 mitochondrial ribosomal protein S14 (.1) ATCG00330 50 / 2e-09 ATCG00330.1, RPS14 chloroplast ribosomal protein S14 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017877 [exp] 206 / 6e-71 AT2G34520 131 / 2e-40 mitochondrial ribosomal protein S14 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G424950 [exp] 154 / 2e-50 AT2G34520 134 / 1e-41 mitochondrial ribosomal protein S14 (.1) Potri.013G142336 [exp] 50 / 4e-09 ATCG00330 164 / 2e-54 chloroplast ribosomal protein S14 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00253 [flax] [poplar] Ribosomal_S14 Ribosomal protein S14p/S29e
Representative CDS sequence Show only first row Show all	>Lus10034657 pacid=23162846 polypeptide=Lus10034657 locus=Lus10034657.g ID=Lus10034657.BGIv1.0 annot-version=v1.0 ATGTGGGAGGACGAGCCAAAGTGCATAAAAGATAACAATCGTAGATTGTTAGCAGAAAAATTCGAGTTGAAGAGGAATCTCTACAAAGCCTTTATTAGAG ATCCTCAGCTTCCAGCTGAAATGCGCGAGAAACTCACTGCTAAGCTGTCCAGGTTGCCCAGGAATAGCTCCTTCACACGGATTCGAAACCGGTGTATCTT CTCCGGTCGCCCTCGCGGTGTTTATGAATTCTTCAGAATGTCTCGTATCGTTTTCCGCACATTAGCAAATCAAGGAAAGCTCAATGGCGTCAAGAAGGCT TCGTGGTGA
AA sequence Show only first row Show all	>Lus10034657 pacid=23162846 polypeptide=Lus10034657 locus=Lus10034657.g ID=Lus10034657.BGIv1.0 annot-version=v1.0 MWEDEPKCIKDNNRRLLAEKFELKRNLYKAFIRDPQLPAEMREKLTAKLSRLPRNSSFTRIRNRCIFSGRPRGVYEFFRMSRIVFRTLANQGKLNGVKKA SW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G34520		RPS14	mitochondrial ribosomal protei...		Lus10034657 [exp]	0	1
AT3G06890			unknown protein		Lus10037501 [exp]	1.4	0.9039
AT2G18390		HAL, ARL2, TTN5...	TITAN 5, HALLIMASCH, ARF-LIKE ...		Lus10026383 [exp]	3.5	0.9112
AT5G63220			unknown protein		Lus10036505 [exp]	5.0	0.8857
AT4G02980		ABP1	endoplasmic reticulum auxin bi...		Lus10029633 [exp]	7.5	0.8611
AT1G64750		DSS1(I), ATDSS1...	deletion of SUV3 suppressor 1(...		Lus10013049 [exp]	8.0	0.8666
AT2G20450			Ribosomal protein L14 (.1)		Lus10008246 [exp]	9.0	0.8953
AT2G30410		TFCA, KIS	TUBULIN FOLDING FACTOR A, tubu...		Lus10031896 [exp]	9.8	0.8541
AT5G55630		ATTPK1, ATKCO1	TWO PORE K CHANNEL 1, TWO PORE...		Lus10001912 [exp]	9.8	0.8812
AT5G17250			Alkaline-phosphatase-like fami...		Lus10006806 [exp]	9.9	0.8789
AT5G49510		PFD3, PDF3	prefoldin 3 (.1.2)		Lus10011145 [exp]	10.4	0.8764

Compare expression of checked genes

Lus10034657 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.