Lus10034661 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G17390 139 / 4e-40 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT3G03290 128 / 3e-36 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT2G03720 125 / 3e-36 MRH6 morphogenesis of root hair 6, Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT1G69080 119 / 4e-33 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
AT1G44760 84 / 8e-20 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT4G13450 59 / 2e-10 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007982 167 / 4e-51 AT5G17390 149 / 1e-43 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10019173 155 / 5e-47 AT1G69080 192 / 2e-61 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10036814 111 / 1e-31 AT1G69080 109 / 7e-32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10042701 75 / 2e-16 AT1G44760 235 / 6e-79 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10029664 73 / 1e-15 AT1G44760 236 / 2e-79 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10025644 68 / 6e-14 AT1G44760 211 / 1e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10018190 65 / 6e-13 AT1G44760 197 / 1e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10014459 64 / 4e-12 AT4G13450 195 / 8e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10023716 62 / 4e-12 AT4G13450 136 / 2e-41 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G060700 179 / 1e-56 AT3G03290 198 / 2e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.010G140200 154 / 1e-46 AT1G69080 202 / 3e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.T170801 150 / 4e-45 AT1G69080 196 / 3e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.008G109000 150 / 4e-45 AT1G69080 196 / 6e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.005G177100 84 / 1e-19 AT1G44760 226 / 3e-75 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.002G084600 75 / 3e-16 AT1G44760 200 / 5e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.010G064800 70 / 1e-14 AT4G13450 194 / 4e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0039 HUP PF00582 Usp Universal stress protein family
Representative CDS sequence
>Lus10034661 pacid=23162730 polypeptide=Lus10034661 locus=Lus10034661.g ID=Lus10034661.BGIv1.0 annot-version=v1.0
ATGTGCAGCGGCGTCGGTGCCCGGTCAATGACCCGGATCCGGGTTCGGTCTCCGTCGGTGGTTCGCCGTTCACCCAAACCCAACAACACCTCCGGCTACA
GACGAAGCAGTTCCGAGGACAGCATTGATTTCGATGATGGGTTTGGGAGTATGAATAAGAAGATGAGCAATAATAATAAGGTGATGGTGGTGGTGGATTC
AGGGGCGGAAGCTAAGGCTGCTCTGGAACTGGCACTTTCCCACACTGTTCAAACTCACGACTCCATCCTTCTCCTCTATGTCGCAAATCAACCATCTAGT
ACTACTCCTCCTAGTGAAGGTTATGAGCTTCTCTGCTCTTTGAAGAACTTGTGCCAGAGGAAAAGGCCAGGGGTGAATGTGGAGTTGATAATAAGGGAGG
GGAAGAACAGGGGAGGCGTGATAGTGGAAGAGGCGAAGAAAGAGAGGGTTTCCTTGGTGGTGATGGGGCAGAGGAAGCGGTGGGTGATGTGGCGGCTGAT
TCAGAGGTTGAAGAGCAGGAAGATCCACGGCGGCGGCGGAGAAAATGAGGCGGTGGTTAAGTATTGCATACAGAATTCAGGGTGCTTGACGATTGCGGTG
AGGAGGCAGGGCAAGAAGCTGGGTGGGTATTTGATTACTACAAAGCGTCACAAGAACTTCTGGCTGTTGGCTTAA
AA sequence
>Lus10034661 pacid=23162730 polypeptide=Lus10034661 locus=Lus10034661.g ID=Lus10034661.BGIv1.0 annot-version=v1.0
MCSGVGARSMTRIRVRSPSVVRRSPKPNNTSGYRRSSSEDSIDFDDGFGSMNKKMSNNNKVMVVVDSGAEAKAALELALSHTVQTHDSILLLYVANQPSS
TTPPSEGYELLCSLKNLCQRKRPGVNVELIIREGKNRGGVIVEEAKKERVSLVVMGQRKRWVMWRLIQRLKSRKIHGGGGENEAVVKYCIQNSGCLTIAV
RRQGKKLGGYLITTKRHKNFWLLA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G17390 Adenine nucleotide alpha hydro... Lus10034661 0 1
AT2G17270 PHT3;3 phosphate transporter 3;3 (.1) Lus10035975 1.4 0.9781
Lus10041251 3.5 0.9703
AT3G45230 hydroxyproline-rich glycoprote... Lus10041306 4.0 0.9532
AT4G38400 ATEXPL2, ATHEXP... EXPANSIN L2, expansin-like A2 ... Lus10025116 5.7 0.9466
AT4G23610 Late embryogenesis abundant (L... Lus10027179 6.0 0.9629
AT4G24910 Protein of unknown function (D... Lus10003160 6.0 0.9644
AT2G28790 Pathogenesis-related thaumatin... Lus10040843 6.5 0.9574
AT1G31490 HXXXD-type acyl-transferase fa... Lus10023806 6.9 0.9611
AT2G38600 HAD superfamily, subfamily III... Lus10017060 7.7 0.9448
AT4G24910 Protein of unknown function (D... Lus10002345 8.4 0.9612

Lus10034661 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.