Lus10034668 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G08100 468 / 3e-167 ASPGA1 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
AT3G16150 332 / 9e-114 ASPGB1 asparaginase B1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
AT4G00590 82 / 2e-17 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
AT5G61540 80 / 1e-16 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034655 605 / 0 AT5G08100 507 / 0.0 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Lus10024795 317 / 2e-107 AT3G16150 536 / 0.0 asparaginase B1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Lus10017879 166 / 1e-50 AT5G08100 157 / 4e-48 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Lus10009826 85 / 4e-18 AT4G00590 446 / 2e-156 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Lus10040935 82 / 3e-17 AT4G00590 484 / 8e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Lus10009560 82 / 3e-17 AT5G61540 518 / 0.0 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Lus10020385 77 / 2e-15 AT5G61540 429 / 1e-147 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G063400 495 / 4e-178 AT5G08100 485 / 2e-174 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Potri.002G122900 335 / 8e-115 AT3G16150 540 / 0.0 asparaginase B1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Potri.014G022900 332 / 2e-113 AT3G16150 556 / 0.0 asparaginase B1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Potri.014G080600 81 / 1e-16 AT4G00590 486 / 1e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Potri.014G191900 73 / 3e-14 AT5G61540 497 / 2e-177 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0052 NTN PF01112 Asparaginase_2 Asparaginase
Representative CDS sequence
>Lus10034668 pacid=23162720 polypeptide=Lus10034668 locus=Lus10034668.g ID=Lus10034668.BGIv1.0 annot-version=v1.0
ATGGGTTGGGCAATCGCTCTTCACGGCGGCGGCGGCGACATACCACGCTCTCTTATGCCCGATGGCCGCCTCCCCCGTGAAGCCGCTCTCCGCCACTGCC
TCCAGCTTGGTGTCTCCGCTCTTCAGTCCCACTCCCACCCTCTTGCCGTCGTTGAGCTCGTGGTTCGTGAATTGGAGAACCACCCACAGTTCAATGCTGG
TAAGGGATCTGTACTAACCACTGCTGGGACAGTGGAGATGGAAGCTAGCATCATGGATGGCAAAACAAAGAACTGTGGAGCAGTTTCTGGACTTACCACT
GTTGTCAATGCTATCTCGCTTGCACGCCTCGTCATGGATAAGACTCCTCACATCTATCTGGGGTTCCAAGGAGCTGAAGCTTTTGCAAGGGAACAAGGTG
TAGAGACAGTTGATCCAAGTTATTTTATTACTCCCGAAAATATCGAGAGGCTGAAGCAGGCCAAAGAAGCCAACAGAGTTCAGATTGACTACACACAACC
AATCAAGAAAGGCGAGAAGCATGACCAAACTGTGGCAGTCGACAGTAGCGGGGACAGCCAAATCGGAACAGTTGGATGTGTGGCTGTTGACGGGGAAGGG
AACTTAGCAGCTGCAACTTCTACAGGCGGACTAGTTAATAAGATGGTGGGGAGGATCGGTGACTCACCTCTGATCGGTGCAGGGACATACGCCAATAGTT
ACTGTGCAGTTTCGGCAACGGGGCAAGGGGAATTTGTCATACGTGCTACTGCTGCTAGAGATGTTGCTGCTCTTATGGAGTACAAAGGCCTGTCTCTCAA
GGAAGCAGCTGCTTATGTGGTTGATGAGTGTGCTCCTAAGGGGACTTTTGGATTGATCGCTGTGTCTGCTACGGGGGAAGTCACAATGCCGTTCAACATG
ACTGGGATGTTTCGAGCATGTGCTACCGAAGAAGGGTACTCCGAAATCGGGATATGGCATGAGGAGCAAGAATGA
AA sequence
>Lus10034668 pacid=23162720 polypeptide=Lus10034668 locus=Lus10034668.g ID=Lus10034668.BGIv1.0 annot-version=v1.0
MGWAIALHGGGGDIPRSLMPDGRLPREAALRHCLQLGVSALQSHSHPLAVVELVVRELENHPQFNAGKGSVLTTAGTVEMEASIMDGKTKNCGAVSGLTT
VVNAISLARLVMDKTPHIYLGFQGAEAFAREQGVETVDPSYFITPENIERLKQAKEANRVQIDYTQPIKKGEKHDQTVAVDSSGDSQIGTVGCVAVDGEG
NLAAATSTGGLVNKMVGRIGDSPLIGAGTYANSYCAVSATGQGEFVIRATAARDVAALMEYKGLSLKEAAAYVVDECAPKGTFGLIAVSATGEVTMPFNM
TGMFRACATEEGYSEIGIWHEEQE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G08100 ASPGA1 asparaginase A1, N-terminal nu... Lus10034668 0 1
AT5G42180 PER64 peroxidase 64, Peroxidase supe... Lus10034547 2.2 0.9402
AT4G25050 ACP4 acyl carrier protein 4 (.1.2) Lus10018986 4.5 0.9297
AT5G25140 CYP71B13 "cytochrome P450, family 71, s... Lus10018263 8.8 0.9344
AT2G23620 ATMES1 ARABIDOPSIS THALIANA METHYL ES... Lus10038592 9.3 0.9104
AT4G28890 RING/U-box superfamily protein... Lus10011702 9.5 0.9220
AT1G50650 Stigma-specific Stig1 family p... Lus10006512 9.6 0.9085
AT3G26170 CYP71B19 "cytochrome P450, family 71, s... Lus10018261 11.7 0.9380
AT5G53970 TAT7 tyrosine aminotransferase 7, T... Lus10013676 12.7 0.8903
AT3G24570 Peroxisomal membrane 22 kDa (M... Lus10022130 12.8 0.9224
AT5G57620 MYB ATMYB36 myb domain protein 36 (.1) Lus10016139 14.1 0.9251

Lus10034668 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.