Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G08040 44 / 1e-07 TOM5 mitochondrial import receptor subunit TOM5 homolog (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G058500 [exp] 45 / 7e-08 AT5G08040 85 / 2e-24 mitochondrial import receptor subunit TOM5 homolog (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034683 pacid=23162812 polypeptide=Lus10034683 locus=Lus10034683.g ID=Lus10034683.BGIv1.0 annot-version=v1.0 ATGGTGAAATCACCCGTTTCTCTCGATAAAATCAAGGCCGTATGGCACTCTCAAGTTCATGATGAGCAGAACTGGGAGGTCAACAAGGAAGGCCAACATG CCTATACATATTCTCGTACACATGTTGCCCCGAAAATTCTCGGAAGCCATTTCCTTCCTGGTTCGGCCTTCTTGATACCTGTGCAACATAGAATGTGCCC GTTAGCACAGTTGGTTGTATTGTGTGGTTAG
AA sequence Show only first row Show all	>Lus10034683 pacid=23162812 polypeptide=Lus10034683 locus=Lus10034683.g ID=Lus10034683.BGIv1.0 annot-version=v1.0 MVKSPVSLDKIKAVWHSQVHDEQNWEVNKEGQHAYTYSRTHVAPKILGSHFLPGSAFLIPVQHRMCPLAQLVVLCG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G08040		TOM5	mitochondrial import receptor ...		Lus10034683 [exp]	0	1
AT2G19380			RNA recognition motif (RRM)-co...		Lus10020460 [exp]	44.6	0.6327
AT1G20450		LTI45, ERD10, L...	LOW TEMPERATURE INDUCED 45, LO...		Lus10005652 [exp]	57.5	0.6337
AT1G79490		EMB2217	embryo defective 2217, Pentatr...		Lus10002871 [exp]	88.0	0.6101
AT1G30845			unknown protein		Lus10023982 [exp]	192.2	0.5950

Compare expression of checked genes

Lus10034683 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.