Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G07960 169 / 4e-56 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021623 [exp] 211 / 1e-72 AT5G07960 169 / 4e-56 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G056300 [exp] 177 / 2e-59 AT5G07960 165 / 1e-54 unknown protein Potri.012G065500 [exp] 171 / 9e-57 AT5G07960 171 / 7e-57 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03669 [flax] [poplar] UPF0139 Uncharacterised protein family (UPF0139)
Representative CDS sequence Show only first row Show all	>Lus10034695 pacid=23162797 polypeptide=Lus10034695 locus=Lus10034695.g ID=Lus10034695.BGIv1.0 annot-version=v1.0 ATGTCGTCGACGAATGATCCAAGACAGCCGACGACGGCGAAGCCGTATGCCTCGCCGATGGTAGCGCCGGAGGATATGCCCGTCGATTACTCGGGTTTCA TCGCTGTGCTCTGCGGTGTTGCCGGTGTCATGTTCAGGTATAAGCTTTGCTCTTGGCTTGCCATAATATTCTGCGCCCAGTCTCTTGCCAACATGAGGAA TATTGAGAACGACCTCAAGCAGATCTCAATGGCCTCCATGTTTGCAATCATGGGGCTGGTAACGAACTACATGGGTCCTCCTCGACCCGGCAGTGCTCCC AACACAAAAACTTGA
AA sequence Show only first row Show all	>Lus10034695 pacid=23162797 polypeptide=Lus10034695 locus=Lus10034695.g ID=Lus10034695.BGIv1.0 annot-version=v1.0 MSSTNDPRQPTTAKPYASPMVAPEDMPVDYSGFIAVLCGVAGVMFRYKLCSWLAIIFCAQSLANMRNIENDLKQISMASMFAIMGLVTNYMGPPRPGSAP NTKT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G07960			unknown protein		Lus10034695 [exp]	0	1
AT5G07960			unknown protein		Lus10021623 [exp]	2.0	0.8889
AT1G76860			Small nuclear ribonucleoprotei...		Lus10011293 [exp]	4.5	0.8676
AT2G19790			SNARE-like superfamily protein...		Lus10012924 [exp]	5.5	0.8770
AT3G22630		PRCGB, PBD1	20S proteasome beta subunit D1...		Lus10041194 [exp]	5.8	0.8848
AT3G17210		ATHS1	A. THALIANA HEAT STABLE PROTEI...		Lus10037823 [exp]	6.5	0.8535
AT5G40580		PBB2	20S proteasome beta subunit PB...		Lus10014581 [exp]	10.2	0.8485
AT1G05205			unknown protein		Lus10039669 [exp]	11.0	0.8657
AT1G74340		DPMS2, DPMS	dolichol phosphate mannose syn...		Lus10030984 [exp]	11.1	0.7812
AT3G52730			ubiquinol-cytochrome C reducta...		Lus10014198 [exp]	12.0	0.8564
AT3G47810		ATVPS29, MAG1	VACUOLAR PROTEIN SORTING 29, M...		Lus10012851 [exp]	12.4	0.7637

Compare expression of checked genes

Lus10034695 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.