Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G18400 76 / 2e-16 NAC ANAC058 NAC domain containing protein 58 (.1) AT2G24430 74 / 2e-15 NAC ANAC039, ANAC038 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) AT3G04060 72 / 5e-15 NAC ANAC046 NAC domain containing protein 46 (.1) AT3G12977 71 / 8e-15 NAC NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT5G18270 70 / 5e-14 NAC ANAC087 Arabidopsis NAC domain containing protein 87 (.1.2) AT5G39610 67 / 2e-13 NAC ORE1, AtNAC2, ANAC092, ATNAC6 ORESARA 1, NAC domain containing protein 2, Arabidopsis NAC domain containing protein 92, NAC domain containing protein 6 (.1) AT1G76420 67 / 6e-13 NAC NAC368, CUC3, ANAC031 CUP SHAPED COTYLEDON3, Arabidopsis NAC domain containing protein 31, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT5G53950 67 / 6e-13 NAC ATCUC2, CUC2, ANAC098 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT5G62380 66 / 1e-12 NAC ANAC101, VND6 VASCULAR-RELATED NAC-DOMAIN 6, NAC-domain protein 101 (.1) AT1G56010 65 / 3e-12 NAC NAC1, ANAC021, ANAC022 Arabidopsis NAC domain containing protein 22, Arabidopsis NAC domain containing protein 21, NAC domain containing protein 1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003458 [exp] 92 / 6e-23 AT4G27410 65 / 2e-12 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Lus10015743 [exp] 84 / 4e-20 AT3G12910 60 / 9e-11 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10020165 [exp] 77 / 3e-16 AT2G24430 306 / 2e-102 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Lus10026966 [exp] 74 / 2e-15 AT2G24430 311 / 6e-105 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Lus10003269 [exp] 72 / 1e-14 AT3G04070 324 / 3e-109 NAC domain containing protein 47 (.1.2) Lus10006547 [exp] 72 / 2e-14 AT3G04070 337 / 4e-114 NAC domain containing protein 47 (.1.2) Lus10009029 [exp] 70 / 5e-14 AT3G18400 311 / 3e-105 NAC domain containing protein 58 (.1) Lus10038937 [exp] 69 / 7e-14 AT3G18400 268 / 5e-89 NAC domain containing protein 58 (.1) Lus10027227 [exp] 69 / 8e-14 AT3G18400 275 / 1e-91 NAC domain containing protein 58 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G005800 [exp] 86 / 1e-19 AT1G76420 326 / 7e-110 CUP SHAPED COTYLEDON3, Arabidopsis NAC domain containing protein 31, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.005G255900 [exp] 83 / 1e-18 AT1G76420 295 / 4e-98 CUP SHAPED COTYLEDON3, Arabidopsis NAC domain containing protein 31, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.019G031600 [exp] 77 / 3e-16 AT5G18270 328 / 6e-111 Arabidopsis NAC domain containing protein 87 (.1.2) Potri.018G003800 [exp] 76 / 3e-16 AT2G24430 350 / 1e-120 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Potri.006G277000 [exp] 76 / 4e-16 AT2G24430 340 / 1e-116 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Potri.013G054200 [exp] 75 / 1e-15 AT5G18270 339 / 4e-115 Arabidopsis NAC domain containing protein 87 (.1.2) Potri.004G049500 [exp] 73 / 4e-15 AT1G61110 232 / 4e-74 NAC domain containing protein 25 (.1) Potri.012G056300 [exp] 69 / 6e-14 AT3G18400 317 / 6e-108 NAC domain containing protein 58 (.1) Potri.017G086200 [exp] 69 / 8e-14 AT5G61430 386 / 2e-134 NAC domain containing protein 100 (.1) Potri.015G046800 [exp] 69 / 1e-13 AT3G18400 326 / 1e-111 NAC domain containing protein 58 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10034700 pacid=23162867 polypeptide=Lus10034700 locus=Lus10034700.g ID=Lus10034700.BGIv1.0 annot-version=v1.0 ATGGGGATAGTGATGGAGCACGATCATGACTCGGCGATAAGCCACCTACAATCATCATCGCCACAGCCATTTGAAAAAGAAGCTGCGGCGGAGGAGATCA GTGTCCCCGGTGGTGGTTTACCGGTAGGGTACAGGTTTCGGCCGACGGACGTGGAATTGGTGAAACATTACTTGATGGAGAAGGCATTTAATCCCGCATC TCCACTTCCGGCCTTCATCGGCCTTGATATCGACGCCTTCGAGTTTTGCAGTATGACTCCTTCCGATCTAGTGCCTCGTTCTCGTCGAGCAGAAAGAGAG TGGTTTTTCTTCGTACGTTTAGATCTAGAAAATGCGAGTAATCAAAATTTTGAAGGAATGATGTCAAAACGAGCAGGGAAGAAAGGAGTAGGATTCTGGA TATCAGGTTTGAAAAAAATGATTTACGATTCCACCGGGGCACTACTAGCCTACAAGTCTGAGTTAACTTATTGTGTAGCAAGTACGGTTTCTTCCTCTCG TCAAAGAAAAACTCACTGGAAACTTGACGAGTATCGACTCCACAGTCCTCTAAATCTCAGGGGACAGGAATGGTTACTTGCAAGGCTGAAGAGAGGATCT GATTACGAGAAGAAGTATTCATAG
AA sequence Show only first row Show all	>Lus10034700 pacid=23162867 polypeptide=Lus10034700 locus=Lus10034700.g ID=Lus10034700.BGIv1.0 annot-version=v1.0 MGIVMEHDHDSAISHLQSSSPQPFEKEAAAEEISVPGGGLPVGYRFRPTDVELVKHYLMEKAFNPASPLPAFIGLDIDAFEFCSMTPSDLVPRSRRAERE WFFFVRLDLENASNQNFEGMMSKRAGKKGVGFWISGLKKMIYDSTGALLAYKSELTYCVASTVSSSRQRKTHWKLDEYRLHSPLNLRGQEWLLARLKRGS DYEKKYS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G18400	NAC	ANAC058	NAC domain containing protein ...		Lus10034700 [exp]	0	1

Compare expression of checked genes

Lus10034700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.