Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G25440 74 / 4e-17 C3HZnF ZFWD1 zinc finger WD40 repeat protein 1 (.1) AT5G51980 71 / 2e-16 C3HZnF Transducin/WD40 repeat-like superfamily protein (.1.2) AT5G40880 61 / 8e-13 WD-40 repeat family protein / zfwd3 protein (ZFWD3) (.1) AT5G49200 60 / 3e-12 C3HZnF WD-40 repeat family protein / zfwd4 protein (ZFWD4) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001652 [exp] 136 / 2e-42 AT5G51980 192 / 2e-59 Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10021656 [exp] 108 / 2e-29 AT4G25440 329 / 9e-109 zinc finger WD40 repeat protein 1 (.1) Lus10021655 [exp] 105 / 8e-29 AT4G25440 169 / 3e-48 zinc finger WD40 repeat protein 1 (.1) Lus10034716 [exp] 98 / 3e-26 AT5G51980 217 / 5e-67 Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10004085 [exp] 91 / 2e-25 AT4G25440 145 / 1e-42 zinc finger WD40 repeat protein 1 (.1) Lus10014598 [exp] 89 / 3e-23 AT4G25440 134 / 2e-36 zinc finger WD40 repeat protein 1 (.1) Lus10014612 [exp] 89 / 3e-23 AT5G40880 131 / 3e-35 WD-40 repeat family protein / zfwd3 protein (ZFWD3) (.1) Lus10014595 [exp] 89 / 2e-22 AT5G14250 445 / 3e-150 FUSCA 11, COP9 SIGNALOSOME SUBUNIT 3, CONSTITUTIVE PHOTOMORPHOGENIC 13, Proteasome component (PCI) domain protein (.1), Proteasome component (PCI) domain protein (.2) Lus10021640 [exp] 85 / 2e-22 AT4G25440 185 / 7e-57 zinc finger WD40 repeat protein 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G134800 [exp] 77 / 2e-18 AT4G25440 600 / 0.0 zinc finger WD40 repeat protein 1 (.1) Potri.014G077800 [exp] 75 / 1e-17 AT5G51980 391 / 5e-132 Transducin/WD40 repeat-like superfamily protein (.1.2) Potri.015G137200 [exp] 74 / 3e-17 AT4G25440 587 / 0.0 zinc finger WD40 repeat protein 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034704 pacid=23162795 polypeptide=Lus10034704 locus=Lus10034704.g ID=Lus10034704.BGIv1.0 annot-version=v1.0 ATGCTGTTGTGCTCTTCGAACAATGATTCAGTTGGATTGTATGAGCTTCCATCATTTGTTGAGAAAGGGAGAATGTACTCGAAATGTGAAGTGAGGGTCT TGGGAGTAGGTACTGGAGGGATGTTCTTCACTGGAGATGCTTCTGGAATGGTGACTGTATGGAAACTGCAGAAGAAGCGAAAATGGAGCAGTATAGGTAT AGTTTGA
AA sequence Show only first row Show all	>Lus10034704 pacid=23162795 polypeptide=Lus10034704 locus=Lus10034704.g ID=Lus10034704.BGIv1.0 annot-version=v1.0 MLLCSSNNDSVGLYELPSFVEKGRMYSKCEVRVLGVGTGGMFFTGDASGMVTVWKLQKKRKWSSIGIV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G25440	C3HZnF	ZFWD1	zinc finger WD40 repeat protei...		Lus10034704 [exp]	0	1
AT2G28180		CHX08, ATCHX8	CATION/H+ EXCHANGER 8, Cation...		Lus10021415 [exp]	16.6	0.6864
AT3G47570			Leucine-rich repeat protein ki...		Lus10030636 [exp]	23.5	0.6724
AT1G13810			Restriction endonuclease, type...		Lus10033589 [exp]	26.8	0.6415
AT2G34930			disease resistance family prot...		Lus10039514 [exp]	29.3	0.5494
AT5G20040		ATIPT9	ARABIDOPSIS THALIANA ISOPENTEN...		Lus10012051 [exp]	35.1	0.6180
AT5G53500			Transducin/WD40 repeat-like su...		Lus10017902 [exp]	45.5	0.6116
AT4G10955			alpha/beta-Hydrolases superfam...		Lus10032396 [exp]	46.4	0.5081
AT5G59810		ATSBT5.4	Subtilase family protein (.1)		Lus10008982 [exp]	51.5	0.5972
AT4G26220			S-adenosyl-L-methionine-depend...		Lus10012913 [exp]	78.5	0.5203
AT2G40300		ATFER4	ferritin 4 (.1)		Lus10017433 [exp]	95.3	0.5799

Compare expression of checked genes

Lus10034704 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.