Lus10034706 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G61220 104 / 6e-31 LYR family of Fe/S cluster biogenesis protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021653 184 / 4e-62 AT5G61220 105 / 4e-31 LYR family of Fe/S cluster biogenesis protein (.1)
Lus10003467 166 / 3e-55 AT5G61220 104 / 6e-31 LYR family of Fe/S cluster biogenesis protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G079800 146 / 2e-47 AT5G61220 97 / 7e-28 LYR family of Fe/S cluster biogenesis protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0491 LYR-like PF05347 Complex1_LYR Complex 1 protein (LYR family)
Representative CDS sequence
>Lus10034706 pacid=23162808 polypeptide=Lus10034706 locus=Lus10034706.g ID=Lus10034706.BGIv1.0 annot-version=v1.0
ATGGCGTCGGCCAGAAGCTTGTCAAGGGGCGAAATCCTCTCCCTTTACCGTTCCCTCCTGCGCACAGCTCGCCAGTTTAGCGACTACAACATCCGGGAGT
ACGCCAAGCGTCGTACGGTCGATGGCTTCCGGCAGAACCAAGGTTTAACGGACCCCGTTTCCGTTTCCGCCGCATACTCCGACGGGAAGTCTCAATTCGA
AGTCGCCAAGAGACAGGCTGTCGTGTACTCGCTCTACGCCCCTAAAATCAAGAGCGTGATGGAGACCGACTTGAAAGGCAAGCGCTGA
AA sequence
>Lus10034706 pacid=23162808 polypeptide=Lus10034706 locus=Lus10034706.g ID=Lus10034706.BGIv1.0 annot-version=v1.0
MASARSLSRGEILSLYRSLLRTARQFSDYNIREYAKRRTVDGFRQNQGLTDPVSVSAAYSDGKSQFEVAKRQAVVYSLYAPKIKSVMETDLKGKR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G61220 LYR family of Fe/S cluster bio... Lus10034706 0 1
AT5G06410 DNAJ heat shock N-terminal dom... Lus10029359 9.2 0.7300
AT1G17820 Putative integral membrane pro... Lus10038326 9.4 0.7353
AT4G26100 CKL1, CK1 casein kinase 1 (.1) Lus10011940 10.4 0.7591
AT3G52210 S-adenosyl-L-methionine-depend... Lus10037917 14.3 0.7387
AT4G30935 WRKY ATWRKY32, WRKY3... WRKY DNA-binding protein 32 (.... Lus10036268 18.9 0.7467
AT1G62400 HT1 high leaf temperature 1, Prote... Lus10015541 23.0 0.7222
AT1G51610 Cation efflux family protein (... Lus10034818 31.6 0.6916
AT3G08020 PHD finger family protein (.1) Lus10016404 37.5 0.7307
AT3G54190 Transducin/WD40 repeat-like su... Lus10003237 38.1 0.7322
AT3G12480 CCAAT NF-YC11 "nuclear factor Y, subunit C11... Lus10041638 39.5 0.7247

Lus10034706 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.