Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G61550 76 / 1e-16 S-locus lectin protein kinase family protein (.1) AT1G61390 73 / 1e-15 S-locus lectin protein kinase family protein (.1.2) AT1G61610 69 / 3e-14 S-locus lectin protein kinase family protein (.1) AT1G61490 69 / 3e-14 S-locus lectin protein kinase family protein (.1) AT1G61430 69 / 4e-14 S-locus lectin protein kinase family protein (.1) AT1G61380 68 / 6e-14 SD1-29 S-domain-1 29 (.1) AT1G61400 68 / 7e-14 S-locus lectin protein kinase family protein (.1) AT1G61500 68 / 7e-14 S-locus lectin protein kinase family protein (.1) AT1G61370 68 / 8e-14 S-locus lectin protein kinase family protein (.1) AT4G03230 67 / 2e-13 S-locus lectin protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018407 [exp] 150 / 7e-43 AT1G61390 732 / 0.0 S-locus lectin protein kinase family protein (.1.2) Lus10007600 [exp] 150 / 1e-42 AT1G11300 930 / 0.0 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) Lus10020052 [exp] 62 / 8e-12 AT1G11340 858 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10039762 [exp] 60 / 6e-11 AT2G19130 621 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10014812 [exp] 59 / 1e-10 AT4G27290 749 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10014723 [exp] 57 / 4e-10 AT1G11340 255 / 7e-79 S-locus lectin protein kinase family protein (.1) Lus10031592 [exp] 57 / 6e-10 AT4G03230 351 / 3e-107 S-locus lectin protein kinase family protein (.1) Lus10037865 [exp] 57 / 6e-10 AT4G27300 804 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10033748 [exp] 56 / 9e-10 AT2G19130 711 / 0.0 S-locus lectin protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G150800 [exp] 70 / 2e-14 AT4G03230 1206 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.019G119900 [exp] 70 / 2e-14 AT4G03230 974 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G125050 [exp] 66 / 2e-13 AT4G27290 870 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.019G119600 [exp] 66 / 3e-13 AT4G03230 983 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G027900 [exp] 64 / 1e-12 AT4G21390 915 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G027800 [exp] 64 / 2e-12 AT4G21390 941 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.019G120000 [exp] 64 / 3e-12 AT4G03230 967 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G039200 [exp] 62 / 5e-12 AT1G11330 864 / 0.0 S-locus lectin protein kinase family protein (.1.2) Potri.011G037600 [exp] 62 / 7e-12 AT4G21390 899 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G037300 [exp] 62 / 7e-12 AT4G21390 922 / 0.0 S-locus lectin protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01453 [flax] [poplar] B_lectin D-mannose binding lectin
Representative CDS sequence Show only first row Show all	>Lus10034711 pacid=23162749 polypeptide=Lus10034711 locus=Lus10034711.g ID=Lus10034711.BGIv1.0 annot-version=v1.0 ATGGGTCGAGCTGGATTTGCTCTGTTTTCACTGTATGCTCTGTTTATTCTTCTGATAACCAATTTCCCACTCTGTTCTTCGTTAACGAATCTCACTTCCT CTTCCCTTCCGCTCCTCTTAAACCAAACCGTAACCTCCACAAACGAAGTCTTCGAGCTGGGGTTCTTTGCTCCCGACAGCAACAGACTGAGAAGCTTCTA TTTTGCGATCCGATTCAAGCAGACTTCTCCGCAGACGATCGTCTGGGTAGCAAATAGGGAAGCTGCCGTAACGGAGGATTCCGCAAGGCTGTTAGTTAAC GGCGATGGGAACTTGGAGCTGCAGGACGGGAGACGGCGTCGTATTTGGGTGAGGAACGTTAGTTCATCCATTGAACTGCATCGCCGAATTCCAGTCGTTT TGAAGAATCACCGCATCGAATTCGGAGGAGGAATGGAAGGTTGGGAACTGGGGTAG
AA sequence Show only first row Show all	>Lus10034711 pacid=23162749 polypeptide=Lus10034711 locus=Lus10034711.g ID=Lus10034711.BGIv1.0 annot-version=v1.0 MGRAGFALFSLYALFILLITNFPLCSSLTNLTSSSLPLLLNQTVTSTNEVFELGFFAPDSNRLRSFYFAIRFKQTSPQTIVWVANREAAVTEDSARLLVN GDGNLELQDGRRRRIWVRNVSSSIELHRRIPVVLKNHRIEFGGGMEGWELG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G61370			S-locus lectin protein kinase ...		Lus10034711 [exp]	0	1
AT3G45290		ATMLO3, MLO3	MILDEW RESISTANCE LOCUS O 3, S...		Lus10011632 [exp]	8.7	0.6613
AT1G13810			Restriction endonuclease, type...		Lus10012108 [exp]	9.7	0.7557
AT1G01140		PKS6, CIPK9, Sn...	SNF1-RELATED PROTEIN KINASE 3....		Lus10030210 [exp]	21.5	0.7447
AT1G08350			Endomembrane protein 70 protei...		Lus10020613 [exp]	33.9	0.7117
AT2G47770		ATTSPO	TSPO(outer membrane tryptophan...		Lus10010281 [exp]	38.5	0.7116
AT3G24110			Calcium-binding EF-hand family...		Lus10007131 [exp]	41.2	0.6261
AT5G07810			SNF2 domain-containing protein...		Lus10015736 [exp]	47.9	0.6828
AT5G56550		ATOXS3	oxidative stress 3 (.1)		Lus10043039 [exp]	50.9	0.6858
AT5G54300			Protein of unknown function (D...		Lus10018444 [exp]	54.0	0.6648
					Lus10038789 [exp]	77.6	0.5910

Compare expression of checked genes

Lus10034711 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.