Lus10034712 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G46720 145 / 2e-44 AIG2-like (avirulence induced gene) family protein (.1)
AT3G02910 130 / 1e-38 AIG2-like (avirulence induced gene) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040635 125 / 4e-37 AT3G02910 135 / 4e-41 AIG2-like (avirulence induced gene) family protein (.1)
Lus10018276 130 / 5e-37 AT3G02910 142 / 4e-41 AIG2-like (avirulence induced gene) family protein (.1)
Lus10040471 0 / 1 ND 52 / 1e-26
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G092600 153 / 2e-47 AT5G46720 144 / 8e-44 AIG2-like (avirulence induced gene) family protein (.1)
Potri.019G041100 143 / 1e-43 AT3G02910 220 / 7e-74 AIG2-like (avirulence induced gene) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0278 AIG2 PF06094 GGACT Gamma-glutamyl cyclotransferase, AIG2-like
Representative CDS sequence
>Lus10034712 pacid=23162765 polypeptide=Lus10034712 locus=Lus10034712.g ID=Lus10034712.BGIv1.0 annot-version=v1.0
ATGGCGGAAGAACCCACCTCCACCACCAGATCCACAACCCAAAAGGACAAAAACGACACCGTAATATTCACCTACGGCACCCTGAAGCGGCGCTTCCCGA
ATCATCACCTCTTGCAAGATCTGATGGCCACCAACGACGCTACTTTCATCTCCTCGTGCGTCACCGTCCATCCGCATCCGCTTGTGATTGGACCCAACGG
AATCCCTTTCCTCATCAACATCCCCGGAGAAGGCCAGAGGGTCAAGGGAGAACTCTACCGCGTGTCGGCGCGTGGAATGGTGCGTGTGGATGAGCTGGAA
GGGACGGAGACGGGGCACTACGAGCGGCTCCCGATCCGCGTGGAGATGGGCGGCGGCGAATCGGAGGAGGCGGAGGCGTATTTTGCGGACAGGGGGTTCG
GGGAGAGGATGTGGAGGAAAGTTGGGGAAGGGCTGAGCGAGTACGGCGAGAAATACGCAGTGGGATACGTTCGGAAAGAGGATCGGCCGGCGGGGACTAA
CTTTCTTCGTGAAATCCAAGTATTCCTGCTCTGA
AA sequence
>Lus10034712 pacid=23162765 polypeptide=Lus10034712 locus=Lus10034712.g ID=Lus10034712.BGIv1.0 annot-version=v1.0
MAEEPTSTTRSTTQKDKNDTVIFTYGTLKRRFPNHHLLQDLMATNDATFISSCVTVHPHPLVIGPNGIPFLINIPGEGQRVKGELYRVSARGMVRVDELE
GTETGHYERLPIRVEMGGGESEEAEAYFADRGFGERMWRKVGEGLSEYGEKYAVGYVRKEDRPAGTNFLREIQVFLL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G46720 AIG2-like (avirulence induced ... Lus10034712 0 1
AT3G17020 Adenine nucleotide alpha hydro... Lus10016900 3.9 0.8540
AT2G47400 CP12-1 CP12 domain-containing protein... Lus10025025 6.6 0.8884
AT1G60870 MEE9 maternal effect embryo arrest ... Lus10022977 6.8 0.8062
AT4G03600 unknown protein Lus10018599 9.5 0.8420
AT1G74070 Cyclophilin-like peptidyl-prol... Lus10008990 16.3 0.8618
AT4G03600 unknown protein Lus10039834 16.9 0.8416
AT1G76080 ATCDSP32, CDSP3... ARABIDOPSIS THALIANA CHLOROPLA... Lus10005624 19.4 0.8294
AT4G30825 Tetratricopeptide repeat (TPR)... Lus10036600 19.4 0.8562
Lus10018772 19.7 0.8566
AT2G37920 EMB1513 embryo defective 1513, copper ... Lus10024339 24.8 0.8439

Lus10034712 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.