Lus10034713 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G47210 86 / 1e-20 MYB myb-like transcription factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021650 164 / 2e-48 AT2G47210 552 / 0.0 myb-like transcription factor family protein (.1)
Lus10015735 123 / 2e-34 AT2G47210 528 / 0.0 myb-like transcription factor family protein (.1)
Lus10003470 122 / 5e-34 AT2G47210 631 / 0.0 myb-like transcription factor family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G117400 100 / 9e-26 AT2G47210 617 / 0.0 myb-like transcription factor family protein (.1)
PFAM info
Representative CDS sequence
>Lus10034713 pacid=23162881 polypeptide=Lus10034713 locus=Lus10034713.g ID=Lus10034713.BGIv1.0 annot-version=v1.0
ATGGAATCTGGTGTCCGTTTGATTGCCCCACATACTGATGAATCTGTAAAACCTGTTGGGGAGAATGACGTTGTTGAGATGACTATTGATCAGAACGAGT
CTGTTTTGCCTCCATCCAATATTCGACTTGCACCTTCGGATTTAGTCATTGCAGATACTGTTTCTACGGTGGCTTCACTGCGTATGCTTCCAGTATACTT
GAGGACGTATGCACTTGAGCAGATGGTGCAACAAGCAAGTTCAATAGCTGGAATTCGTACTATTAAGCGAGTTGAACAAACCTTGCATGATCTTGAACTT
CATGACACCACAGGTCTTAACCATGTCATTTGCTCCACACGAAGACAGATCGCTAATCGGACAGCTTTTTGGCCACAATCGTGA
AA sequence
>Lus10034713 pacid=23162881 polypeptide=Lus10034713 locus=Lus10034713.g ID=Lus10034713.BGIv1.0 annot-version=v1.0
MESGVRLIAPHTDESVKPVGENDVVEMTIDQNESVLPPSNIRLAPSDLVIADTVSTVASLRMLPVYLRTYALEQMVQQASSIAGIRTIKRVEQTLHDLEL
HDTTGLNHVICSTRRQIANRTAFWPQS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G47210 MYB myb-like transcription factor ... Lus10034713 0 1
AT5G59550 zinc finger (C3HC4-type RING f... Lus10010856 1.7 0.8993
AT1G66330 senescence-associated family p... Lus10002290 2.2 0.8770
AT2G17972 unknown protein Lus10013879 4.6 0.8981
AT1G20810 FKBP-like peptidyl-prolyl cis-... Lus10016037 5.5 0.8993
AT4G28570 Long-chain fatty alcohol dehyd... Lus10008239 11.0 0.8448
AT1G08070 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSIN... Lus10033026 12.3 0.8712
AT4G30825 Tetratricopeptide repeat (TPR)... Lus10035818 12.8 0.8595
AT3G52150 RNA-binding (RRM/RBD/RNP motif... Lus10010262 12.8 0.8644
AT2G17972 unknown protein Lus10026591 14.4 0.8448
AT5G27290 unknown protein Lus10018966 14.4 0.8804

Lus10034713 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.