Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02955 40 / 8e-05 MEE12 maternal effect embryo arrest 12 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021646 [exp] 124 / 3e-34 AT2G02955 442 / 4e-147 maternal effect embryo arrest 12 (.1) Lus10012828 [exp] 72 / 3e-17 AT2G02955 68 / 8e-14 maternal effect embryo arrest 12 (.1) Lus10004454 [exp] 52 / 6e-09 AT2G02955 204 / 8e-60 maternal effect embryo arrest 12 (.1) Lus10030476 [exp] 0 / 1 AT2G02955 79 / 5e-16 maternal effect embryo arrest 12 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G169500 [exp] 59 / 1e-11 AT2G02955 513 / 5e-174 maternal effect embryo arrest 12 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034720 pacid=23162793 polypeptide=Lus10034720 locus=Lus10034720.g ID=Lus10034720.BGIv1.0 annot-version=v1.0 ATGGACGACCACGATGACGAGGAGACGATAAAATCCGATTGTCGATCATGCGGCGGTACCGACTTCTGCGAGACCGACGGGTTCTACTACTGCAACTATT GCGGCTCCAAGGCCGAAGGCCTAATGGTCACAGGAACCGCCGACGAGGACTTCATCGACAACAATGGCCGGACCGGACCGCCGTTGCCGCCGGCGGCCTC TACAACGCTAAATCTTCCCGTCGCTCGCAGCCGACAGCGCTCTCTCAGGGCACAGAAGCCAATCCTTCTTCGCAGGCTTGGTATCGGCTAA
AA sequence Show only first row Show all	>Lus10034720 pacid=23162793 polypeptide=Lus10034720 locus=Lus10034720.g ID=Lus10034720.BGIv1.0 annot-version=v1.0 MDDHDDEETIKSDCRSCGGTDFCETDGFYYCNYCGSKAEGLMVTGTADEDFIDNNGRTGPPLPPAASTTLNLPVARSRQRSLRAQKPILLRRLGIG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G02955		MEE12	maternal effect embryo arrest ...		Lus10034720 [exp]	0	1
AT2G22400			S-adenosyl-L-methionine-depend...		Lus10020217 [exp]	6.2	0.9179
AT2G40030		NRPE1, DMS5, AT...	DEFECTIVE IN MERISTEM SILENCIN...		Lus10016333 [exp]	15.4	0.8991
AT3G55160			unknown protein		Lus10007253 [exp]	15.9	0.9062
AT1G20960		EMB1507	embryo defective 1507, U5 smal...		Lus10016048 [exp]	20.9	0.8983
AT1G36990			unknown protein		Lus10029655 [exp]	23.0	0.8892
AT5G61990			Pentatricopeptide repeat (PPR)...		Lus10016727 [exp]	27.3	0.8953
AT2G13540		ENS, CBP80, ABH...	ENSALADA, CAP-BINDING PROTEIN ...		Lus10019032 [exp]	30.0	0.8906
AT1G36990			unknown protein		Lus10042697 [exp]	30.7	0.8754
AT1G20960		EMB1507	embryo defective 1507, U5 smal...		Lus10025168 [exp]	32.1	0.8896
AT1G20960		EMB1507	embryo defective 1507, U5 smal...		Lus10022082 [exp]	32.6	0.8904

Compare expression of checked genes

Lus10034720 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.