Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G60480 67 / 3e-16 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000560 [exp] 121 / 4e-38 AT3G60480 95 / 1e-26 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G054300 [exp] 65 / 1e-15 AT3G60480 89 / 3e-24 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034728 pacid=23162891 polypeptide=Lus10034728 locus=Lus10034728.g ID=Lus10034728.BGIv1.0 annot-version=v1.0 ATGCCGTTGAAAGCGTTCGCAGTTGCATCTCTGTTTGTGGGATCCGCTGCTTCGGCCTCCTTCTGCGCCCTTCGTGCTTCCGGCATCCACAAGGTTGAGG ATCTGGTGCAGGTGGGTGCAGGTATAAGGACCCAGCTCGGGATCCCTTCAAGGCCACATCACAAGAGGAGAGATTCTTGA
AA sequence Show only first row Show all	>Lus10034728 pacid=23162891 polypeptide=Lus10034728 locus=Lus10034728.g ID=Lus10034728.BGIv1.0 annot-version=v1.0 MPLKAFAVASLFVGSAASASFCALRASGIHKVEDLVQVGAGIRTQLGIPSRPHHKRRDS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G60480			unknown protein		Lus10034728 [exp]	0	1
AT1G43850		SEU	SEUSS transcriptional co-regul...		Lus10029753 [exp]	1.0	0.8200
AT5G04280		AtRZ-1c	AtRZ-1c, RNA-binding (RRM/RBD/...		Lus10000128 [exp]	7.3	0.7116
AT3G59280		TXR1	THAXTOMIN A RESISTANT 1, Prote...		Lus10043207 [exp]	8.5	0.8044
AT4G25270		OTP70	organelle transcript processin...		Lus10031714 [exp]	8.7	0.7908
AT2G26110			Protein of unknown function (D...		Lus10026978 [exp]	9.8	0.7062
AT4G25270		OTP70	organelle transcript processin...		Lus10031134 [exp]	10.8	0.7740
AT4G15720			Tetratricopeptide repeat (TPR)...		Lus10006517 [exp]	12.4	0.7386
AT5G47630		MTACP3	mitochondrial acyl carrier pro...		Lus10038782 [exp]	14.8	0.7233
AT2G32520			alpha/beta-Hydrolases superfam...		Lus10035287 [exp]	15.9	0.7446
AT3G59520		ATRBL13	RHOMBOID-like protein 13 (.1)		Lus10008156 [exp]	20.4	0.7361

Compare expression of checked genes

Lus10034728 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.