Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G129500 [exp] 129 / 2e-41 ND /
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04419 [flax] [poplar] 4F5 4F5 protein related disordered region
Representative CDS sequence Show only first row Show all	>Lus10034731 pacid=23142212 polypeptide=Lus10034731 locus=Lus10034731.g ID=Lus10034731.BGIv1.0 annot-version=v1.0 ATGACTCGAGGAAAGCAGAAGATAGAAGCGCAGCGCAAAAATGCAGAGAAGAATCAGAAGAACAAGGGCTCTCAGTTTGAGGCCAGAGTTGTTGCTCTCA AAGTTACTTGCCCCATCTGCAAGGTACAATTAGCAAATCAGAATCAGCTCGGGGATCATTATGGAGCTAAACATCCAAAGGAAAAGCCCCCTGCTGAATC AAGTTGA
AA sequence Show only first row Show all	>Lus10034731 pacid=23142212 polypeptide=Lus10034731 locus=Lus10034731.g ID=Lus10034731.BGIv1.0 annot-version=v1.0 MTRGKQKIEAQRKNAEKNQKNKGSQFEARVVALKVTCPICKVQLANQNQLGDHYGAKHPKEKPPAESS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10034731 [exp]	0	1
AT5G39510		ZIG1, SGR4, ATV...	SHOOT GRAVITROPSIM 4, VESICLE ...		Lus10021624 [exp]	1.7	0.9403
AT2G25950			Protein of unknown function (D...		Lus10007454 [exp]	6.3	0.9337
AT5G03460			unknown protein		Lus10014419 [exp]	7.7	0.9029
AT5G39510		ZIG1, SGR4, ATV...	SHOOT GRAVITROPSIM 4, VESICLE ...		Lus10034696 [exp]	8.1	0.9322
AT5G39950		ATTRXH2, ATTRX2...	Arabidopsis thioredoxin h2, th...		Lus10030666 [exp]	8.7	0.9006
AT3G46060		ARA3, Ara-3, At...	RAB GTPase homolog 8A (.1.2.3)		Lus10025309 [exp]	9.2	0.9080
AT5G04750			F1F0-ATPase inhibitor protein,...		Lus10034146 [exp]	9.7	0.8948
AT5G11970			Protein of unknown function (D...		Lus10021581 [exp]	11.6	0.8877
AT1G61780			postsynaptic protein-related (...		Lus10007644 [exp]	11.8	0.8844
AT3G13200		EMB2769	EMBRYO DEFECTIVE 2769, Cwf15 /...		Lus10016651 [exp]	12.8	0.9164

Compare expression of checked genes

Lus10034731 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.