Lus10034743 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016931 72 / 5e-18 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10034743 pacid=23142303 polypeptide=Lus10034743 locus=Lus10034743.g ID=Lus10034743.BGIv1.0 annot-version=v1.0
ATGTCGACCATCTCCTTCCTCAATGAAGTCGACGACGCGGCCCCTTCATCAATCGCCATCTCCTTCTTTGGTTGGCGTCGCTCGATGAAGCCTCTCCTCC
TCCGTCGATTATCGGAAAGCAAGGAAACCTACTCCCAGATCGGGGAGGCGAAGTACACCGGAACTAGGGACAAACGTGCAGTGTGGATGACTGGGCCTCT
TAACTACTGCAACCTTAAGTGGATGCCTTAA
AA sequence
>Lus10034743 pacid=23142303 polypeptide=Lus10034743 locus=Lus10034743.g ID=Lus10034743.BGIv1.0 annot-version=v1.0
MSTISFLNEVDDAAPSSIAISFFGWRRSMKPLLLRRLSESKETYSQIGEAKYTGTRDKRAVWMTGPLNYCNLKWMP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10034743 0 1
AT5G22450 unknown protein Lus10000530 4.4 1.0000
Lus10003536 7.2 1.0000
AT4G17220 ATMAP70-5 microtubule-associated protein... Lus10003908 7.5 1.0000
Lus10023589 8.4 1.0000
Lus10011078 8.9 1.0000
Lus10012998 10.0 1.0000
Lus10028667 11.0 1.0000
Lus10011425 11.4 1.0000
AT2G20420 ATP citrate lyase (ACL) family... Lus10022902 11.7 1.0000
AT2G45650 MADS AGL6 AGAMOUS-like 6 (.1) Lus10038895 13.3 0.9284

Lus10034743 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.