Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G35612 42 / 4e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033285 [exp] 79 / 2e-19 AT2G35612 42 / 1e-05 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G234800 [exp] 55 / 7e-11 AT2G35612 64 / 6e-15 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034745 pacid=23142246 polypeptide=Lus10034745 locus=Lus10034745.g ID=Lus10034745.BGIv1.0 annot-version=v1.0 ATGCGTCTGTTGACGAGGACGATGATGATGATGATGATGATGGAAGTTCACCATCTCCATCACAACACAACCACTACAAGTACTCTTCTTCTTTTGCTTC TCCTTACAGTCTCAACTACTACAACAGCAACTAGTAGGCCACTTATAAACAACAACAACAACAACCATGATGAGCAACATCAACATCCGCCTCCTCTGCC ACAACCTCCCGGAGCTCCGGGAGGTGGCGGTTTGACTCCTCCAATGCCACCGGGGCCACCGGCTCCAATAAGGGTTGGATTGGCGAACCGTTACAAAGTG ATGGAGGAAGATGCTTACAGACCAACCTCTCCTGGTCATAGCCCTGGCGTTGGTCATAATAGCCCCCCTACTGCTCCATGA
AA sequence Show only first row Show all	>Lus10034745 pacid=23142246 polypeptide=Lus10034745 locus=Lus10034745.g ID=Lus10034745.BGIv1.0 annot-version=v1.0 MRLLTRTMMMMMMMEVHHLHHNTTTTSTLLLLLLLTVSTTTTATSRPLINNNNNNHDEQHQHPPPLPQPPGAPGGGGLTPPMPPGPPAPIRVGLANRYKV MEEDAYRPTSPGHSPGVGHNSPPTAP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G35612			unknown protein		Lus10034745 [exp]	0	1
AT1G02400		ATGA2OX4, ATGA2...	DOWNSTREAM TARGET OF AGL15 1, ...		Lus10004511 [exp]	15.3	0.6998
AT4G12500			Bifunctional inhibitor/lipid-t...		Lus10032258 [exp]	15.7	0.7487
AT1G51340			MATE efflux family protein (.1...		Lus10016412 [exp]	19.6	0.7553
AT5G43540	C2H2ZnF		C2H2 and C2HC zinc fingers sup...		Lus10021881 [exp]	25.8	0.6990
AT2G14830			Regulator of Vps4 activity in ...		Lus10018577 [exp]	29.3	0.6707
					Lus10042473 [exp]	30.4	0.7166
AT1G19250		FMO1	flavin-dependent monooxygenase...		Lus10005178 [exp]	38.3	0.7329
AT3G08040		ATFRD3, MAN1, F...	MANGANESE ACCUMULATOR 1, FERRI...		Lus10016228 [exp]	45.3	0.6990
AT2G37330		ALS3	aluminum sensitive 3 (.1)		Lus10009069 [exp]	46.9	0.7189
					Lus10039764 [exp]	47.7	0.7238

Compare expression of checked genes

Lus10034745 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.