Lus10034752 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008302 229 / 2e-78 ND /
Lus10034740 177 / 2e-57 ND /
Lus10022965 61 / 2e-11 AT2G24430 62 / 1e-10 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2)
Lus10033279 53 / 1e-08 AT5G62380 61 / 5e-10 VASCULAR-RELATED NAC-DOMAIN 6, NAC-domain protein 101 (.1)
Lus10033281 52 / 2e-08 AT1G71930 57 / 4e-09 Arabidopsis NAC domain containing protein 30, vascular related NAC-domain protein 7 (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10034752 pacid=23142227 polypeptide=Lus10034752 locus=Lus10034752.g ID=Lus10034752.BGIv1.0 annot-version=v1.0
ATGGAGGAGGAACAACAAGTACCGCAACCGCCTCAACGTCTCTCGACGCCCCCTCTGGGTTACCACCCTTTCAACCCGTCTGAAGAGGAACTGTTAAGGT
ACAGAAATCATCATAAAACCAGTGGCAAGAGAAAGTTTGATGCTGCTGCGGGTGGCTGTTCCCCACAGCCATCTTCAAAGGTTCCTAGACTCTGTGATGA
TGGAGTTAGTCTTTCTTCTTCTTCTATGCCAACAACTCAGTCTCACAACTCCGAGAATCAAATACGTTGTTATATTGATCCTGATGTTTGGGCATTCCTT
GAGGAAGTGAGAGAACTGAACAGCAAGTCCAGTCCCTCGTCGAAAATCTCAGTCTCTGTCCCATATCCCTTTCATCAGATTCTTCCTTCAACTCTAAGAA
CCCTTAATCTCAAGTGTAATAGGTTGTTCAATATTGAAGTTGAATGTTACTTTGACATGATACCTGGAAAATGA
AA sequence
>Lus10034752 pacid=23142227 polypeptide=Lus10034752 locus=Lus10034752.g ID=Lus10034752.BGIv1.0 annot-version=v1.0
MEEEQQVPQPPQRLSTPPLGYHPFNPSEEELLRYRNHHKTSGKRKFDAAAGGCSPQPSSKVPRLCDDGVSLSSSSMPTTQSHNSENQIRCYIDPDVWAFL
EEVRELNSKSSPSSKISVSVPYPFHQILPSTLRTLNLKCNRLFNIEVECYFDMIPGK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10034752 0 1
Lus10034740 1.4 0.9484
AT4G35600 Kin4, CX32, CST... kinase 4, CONNEXIN 32, CAST AW... Lus10008015 2.8 0.9171
AT2G33490 hydroxyproline-rich glycoprote... Lus10035172 5.5 0.8734
Lus10008302 6.5 0.8906
AT3G51120 DNA binding;zinc ion binding;n... Lus10025974 7.3 0.8939
AT3G54020 AtIPCS1 Arabidopsis Inositol phosphory... Lus10035551 12.6 0.8913
AT4G33920 Protein phosphatase 2C family ... Lus10013896 13.0 0.8935
AT4G11070 WRKY ATWRKY41, WRKY4... WRKY family transcription fact... Lus10001902 13.4 0.8821
AT4G11610 NTRB, ATNTRB C2 calcium/lipid-binding plant... Lus10018839 14.0 0.8698
AT5G48290 Heavy metal transport/detoxifi... Lus10016062 14.3 0.8723

Lus10034752 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.