Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G47550 65 / 1e-14 Cystatin/monellin superfamily protein (.1) AT5G05110 39 / 0.0003 Cystatin/monellin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033311 [exp] 153 / 3e-49 ND 59 / 6e-12 Lus10010495 [exp] 97 / 4e-27 AT5G47550 73 / 1e-17 Cystatin/monellin superfamily protein (.1) Lus10017567 [exp] 94 / 4e-26 AT5G47550 69 / 7e-16 Cystatin/monellin superfamily protein (.1) Lus10039104 [exp] 53 / 4e-10 AT5G47550 74 / 4e-18 Cystatin/monellin superfamily protein (.1) Lus10027320 [exp] 41 / 2e-05 AT5G47550 59 / 4e-12 Cystatin/monellin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G014500 [exp] 57 / 8e-12 AT5G47550 100 / 9e-29 Cystatin/monellin superfamily protein (.1) Potri.006G014700 [exp] 51 / 2e-09 AT5G47550 62 / 3e-13 Cystatin/monellin superfamily protein (.1) Potri.006G014600 [exp] 40 / 2e-05 AT5G47550 56 / 6e-11 Cystatin/monellin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0121 [flax] [poplar] Cystatin PF00031 [flax] [poplar] Cystatin Cystatin domain
Representative CDS sequence Show only first row Show all	>Lus10034773 pacid=23142247 polypeptide=Lus10034773 locus=Lus10034773.g ID=Lus10034773.BGIv1.0 annot-version=v1.0 ATGATGAATTCAAAGGTCCTCGTCGTCACTGCCACAGCCGGATTGGCCGGTGGATGGAACAAGATCGAGAATCCATTGGAGCCAAAAGTGATAGAAGTGG CCCCGTTTGCAGTCAACAAACACAACAATGAATCAGAGACCAAATTGGCGCCAGTGTCGATAACCTCCGGAGCCTACCAAATCATACAGGGAAAGAACTA CCGGTTGAGCCTGGTGGTATTTGACGCCGCCGTCGCAGAGAGAAACGCAATTTCCAACTACGTGGCGGTTGTTTGGGTGTTGCCTGGCGTGGGGAGTCCC AAGAAGTTGATGTTGTGTTTAGGCAGATGA
AA sequence Show only first row Show all	>Lus10034773 pacid=23142247 polypeptide=Lus10034773 locus=Lus10034773.g ID=Lus10034773.BGIv1.0 annot-version=v1.0 MMNSKVLVVTATAGLAGGWNKIENPLEPKVIEVAPFAVNKHNNESETKLAPVSITSGAYQIIQGKNYRLSLVVFDAAVAERNAISNYVAVVWVLPGVGSP KKLMLCLGR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G47550			Cystatin/monellin superfamily ...		Lus10034773 [exp]	0	1
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10029390 [exp]	3.9	0.9115
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10029913 [exp]	5.5	0.9115
					Lus10000400 [exp]	6.7	0.9115
					Lus10009372 [exp]	7.7	0.9115
AT4G29280		LCR22	low-molecular-weight cysteine-...		Lus10015983 [exp]	8.7	0.9115
AT2G29110		ATGLR2.8	glutamate receptor 2.8 (.1)		Lus10026877 [exp]	9.5	0.9115
AT5G18460			Protein of Unknown Function (D...		Lus10006860 [exp]	10.2	0.9115
AT3G45600		TET3	tetraspanin3 (.1)		Lus10023218 [exp]	11.3	0.9036
AT5G63810		BGAL10	beta-galactosidase 10 (.1)		Lus10023977 [exp]	11.6	0.9001
AT5G22860			Serine carboxypeptidase S28 fa...		Lus10021400 [exp]	12.4	0.6212

Compare expression of checked genes

Lus10034773 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.