Lus10034782 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G78995 143 / 3e-44 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033323 223 / 6e-75 AT1G78995 148 / 9e-46 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G003600 135 / 1e-40 AT1G78995 146 / 4e-45 unknown protein
PFAM info
Representative CDS sequence
>Lus10034782 pacid=23142185 polypeptide=Lus10034782 locus=Lus10034782.g ID=Lus10034782.BGIv1.0 annot-version=v1.0
ATGACCACCGCAATCAACTGCCGCAGTGCTAGGAGCAGCAGCAGTACATCTGAAATTAGCCGACGCCTGGTACTAAGGATTGCAGTAAGCCAGCTGGTAG
CTGCCTGCGCGGTGCTATTCATGTCCCCGGAAGCGGCCGGCGGCGCAATAGAGGGAAAGAGAGGTAAGGGAGCGGCGAAAGGAGGCGATGAGGAGGAGGA
GGAGGAGGAGACGCTTGGGAATGTGCCGCAGACGCTGGCGGGAGAATGCGGAGAGGAAGAAGGGAAGGATTGTAACAAGAAGAAGATGAGAATACAGAGA
CCTAAATCCAGAAAAGCTGAGGTTTGCACTGTGAAATGCGTCAACACCTGCATCCGCGGCGATGAAGGCGAAGGCCCTTTCAATATCAGGAGACCTCTGG
TGGTGTTCAAGCAAGGATTCCGTAGCCGCCACTACTGCTTAGTAGAGTGCTCTGACATCTGTAATCTGATCGGAGATGGAGACGATGGCCCCTGA
AA sequence
>Lus10034782 pacid=23142185 polypeptide=Lus10034782 locus=Lus10034782.g ID=Lus10034782.BGIv1.0 annot-version=v1.0
MTTAINCRSARSSSSTSEISRRLVLRIAVSQLVAACAVLFMSPEAAGGAIEGKRGKGAAKGGDEEEEEEETLGNVPQTLAGECGEEEGKDCNKKKMRIQR
PKSRKAEVCTVKCVNTCIRGDEGEGPFNIRRPLVVFKQGFRSRHYCLVECSDICNLIGDGDDGP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G78995 unknown protein Lus10034782 0 1
AT1G55480 ZKT protein containing PDZ domain,... Lus10013403 3.0 0.9335
AT1G55480 ZKT protein containing PDZ domain,... Lus10010322 8.9 0.9236
AT5G07020 proline-rich family protein (.... Lus10024125 12.6 0.9078
AT5G38410 Ribulose bisphosphate carboxyl... Lus10017597 15.5 0.9061
AT3G25805 unknown protein Lus10016741 17.3 0.8923
AT5G38410 Ribulose bisphosphate carboxyl... Lus10033558 18.2 0.9003
AT4G39970 Haloacid dehalogenase-like hyd... Lus10000633 19.3 0.9001
AT1G53670 MSRB1, ATMSRB1 methionine sulfoxide reductase... Lus10013727 22.5 0.8946
AT4G32590 2Fe-2S ferredoxin-like superfa... Lus10041038 23.0 0.8957
AT5G01920 STN8 State transition 8, Protein ki... Lus10022730 24.5 0.8955

Lus10034782 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.