Lus10034783 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G57170 116 / 4e-34 Tautomerase/MIF superfamily protein (.1.2)
AT5G01650 92 / 1e-24 Tautomerase/MIF superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033324 133 / 2e-40 AT5G57170 119 / 1e-35 Tautomerase/MIF superfamily protein (.1.2)
Lus10022681 86 / 8e-22 AT5G01650 172 / 8e-57 Tautomerase/MIF superfamily protein (.1.2)
Lus10014233 81 / 3e-20 AT5G01650 169 / 1e-55 Tautomerase/MIF superfamily protein (.1.2)
Lus10012223 67 / 6e-15 AT5G01650 146 / 9e-47 Tautomerase/MIF superfamily protein (.1.2)
Lus10000344 62 / 3e-13 AT3G51660 96 / 2e-27 Tautomerase/MIF superfamily protein (.1)
Lus10012222 62 / 6e-13 AT3G51660 158 / 1e-51 Tautomerase/MIF superfamily protein (.1)
Lus10000345 44 / 9e-06 AT5G01650 52 / 2e-11 Tautomerase/MIF superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G075100 110 / 1e-31 AT5G57170 194 / 7e-66 Tautomerase/MIF superfamily protein (.1.2)
Potri.006G104500 93 / 5e-25 AT5G01650 200 / 5e-68 Tautomerase/MIF superfamily protein (.1.2)
Potri.016G126500 93 / 7e-25 AT5G01650 193 / 2e-65 Tautomerase/MIF superfamily protein (.1.2)
Potri.016G126800 92 / 1e-24 AT5G01650 185 / 4e-62 Tautomerase/MIF superfamily protein (.1.2)
Potri.006G104600 92 / 2e-24 AT5G01650 180 / 3e-60 Tautomerase/MIF superfamily protein (.1.2)
Potri.016G126600 92 / 2e-24 AT5G01650 216 / 2e-74 Tautomerase/MIF superfamily protein (.1.2)
Potri.016G126700 87 / 1e-22 AT5G01650 164 / 6e-54 Tautomerase/MIF superfamily protein (.1.2)
Potri.006G104800 60 / 5e-12 AT3G51660 151 / 7e-49 Tautomerase/MIF superfamily protein (.1)
Potri.016G127300 59 / 1e-11 AT3G51660 151 / 7e-49 Tautomerase/MIF superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0082 MIF PF01187 MIF Macrophage migration inhibitory factor (MIF)
Representative CDS sequence
>Lus10034783 pacid=23142279 polypeptide=Lus10034783 locus=Lus10034783.g ID=Lus10034783.BGIv1.0 annot-version=v1.0
ATGGCTCCGCCAATGGATGGGCCCATGCCCAGTAGACTCTACGAGCCATCACTTGGCTCAAGCGTCAGGGAGCTAGTCCCAAGGTATGTGATGATAGTGG
TGAACAGCGGGGTACCTATGGCGTTTGCTGGTACGGAGGAGCCTGCTGCATTTGGAGAATTGATTTCGATAGGGGGACTGGGCCCAAGTGTTAACGGGAA
ACTTAGTTCTACCATTGCTGACATTCTTCAAACAAAGGCCTCCATCGACAGCTCCCGATTTTACATAAAGTTTTACGATGTTGAGGGCAGACATCAAGAC
ATGTGGAAATGCAGTGGAAGGAATTTAGGAAAGAAGCGTGCGTGTCATAAGCAGCTTCGTTGGATCTTACGTAGACATTGCCAACTGTCTCCAAATTGTT
TGCCTCTTCCGGCGGCTATATGCTATATATTAGAATCAACAGTAGAGTTGCAACCTCGCTCTCTCAAGCAACTCATCATCCACATAACTGGGTGA
AA sequence
>Lus10034783 pacid=23142279 polypeptide=Lus10034783 locus=Lus10034783.g ID=Lus10034783.BGIv1.0 annot-version=v1.0
MAPPMDGPMPSRLYEPSLGSSVRELVPRYVMIVVNSGVPMAFAGTEEPAAFGELISIGGLGPSVNGKLSSTIADILQTKASIDSSRFYIKFYDVEGRHQD
MWKCSGRNLGKKRACHKQLRWILRRHCQLSPNCLPLPAAICYILESTVELQPRSLKQLIIHITG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G57170 Tautomerase/MIF superfamily pr... Lus10034783 0 1
AT3G47860 CHL chloroplastic lipocalin (.1) Lus10037318 2.8 0.8758
AT4G24470 GATA GATA25, TIFY1, ... Zinc-finger protein expressed ... Lus10042865 3.0 0.8617
Lus10016908 3.7 0.8469
AT3G19800 Protein of unknown function (D... Lus10040969 6.1 0.8865
AT5G26670 Pectinacetylesterase family pr... Lus10000253 6.3 0.8614
AT5G51410 LUC7 N_terminus domain-contain... Lus10027212 8.0 0.8048
AT5G04900 NOL NYC1-like (.1) Lus10034874 13.6 0.8398
AT5G35790 G6PD1 glucose-6-phosphate dehydrogen... Lus10012339 21.6 0.8257
AT3G47490 HNH endonuclease (.1.2.3) Lus10034462 22.0 0.8088
AT2G21370 XK1, XK-1 XYLULOSE KINASE 1, xylulose ki... Lus10017967 22.3 0.8495

Lus10034783 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.