Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G20210 104 / 3e-28 DELTAVPE, DELTA-VPE delta vacuolar processing enzyme (.1.2) AT2G25940 102 / 2e-27 ALPHAVPE, ALPHA-VPE alpha-vacuolar processing enzyme (.1) AT4G32940 96 / 4e-25 GAMMAVPE, GAMMA-VPE gamma vacuolar processing enzyme (.1) AT1G62710 96 / 6e-25 BETAVPE, BETA-VPE beta vacuolar processing enzyme (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033344 [exp] 144 / 6e-43 AT2G25940 473 / 3e-164 alpha-vacuolar processing enzyme (.1) Lus10007450 [exp] 105 / 2e-28 AT4G32940 754 / 0.0 gamma vacuolar processing enzyme (.1) Lus10032236 [exp] 104 / 5e-28 AT1G62710 712 / 0.0 beta vacuolar processing enzyme (.1) Lus10024446 [exp] 103 / 1e-27 AT4G32940 717 / 0.0 gamma vacuolar processing enzyme (.1) Lus10024599 [exp] 102 / 2e-27 AT1G62710 709 / 0.0 beta vacuolar processing enzyme (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G003400 [exp] 116 / 2e-32 AT2G25940 534 / 0.0 alpha-vacuolar processing enzyme (.1) Potri.001G119800 [exp] 105 / 1e-28 AT1G62710 720 / 0.0 beta vacuolar processing enzyme (.1) Potri.003G113300 [exp] 103 / 1e-27 AT1G62710 704 / 0.0 beta vacuolar processing enzyme (.1) Potri.018G059400 [exp] 101 / 5e-27 AT4G32940 752 / 0.0 gamma vacuolar processing enzyme (.1) Potri.006G232900 [exp] 99 / 7e-26 AT4G32940 742 / 0.0 gamma vacuolar processing enzyme (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0093 [flax] [poplar] Peptidase_CD PF01650 [flax] [poplar] Peptidase_C13 Peptidase C13 family
Representative CDS sequence Show only first row Show all	>Lus10034797 pacid=23142206 polypeptide=Lus10034797 locus=Lus10034797.g ID=Lus10034797.BGIv1.0 annot-version=v1.0 ATGTACGACGATATCGCTTTCGACGAGGAAAACCCTCGCCCGGGGGTCGTCATCAACAAGCCCACCGGCGACGATGTCTACTCTGGTGTACTCAAGGACT ATACCAAAGAGAATTGTACGGCTGATAATTTGTACGCCGTAATTCTCGGTAATCAGTCTGCGTTGACCGGCGGCAGTGGCAAAGTGGTGAATAGTGAGCC GGACGACACCGTTTTTTTTCTACTACGCTGA
AA sequence Show only first row Show all	>Lus10034797 pacid=23142206 polypeptide=Lus10034797 locus=Lus10034797.g ID=Lus10034797.BGIv1.0 annot-version=v1.0 MYDDIAFDEENPRPGVVINKPTGDDVYSGVLKDYTKENCTADNLYAVILGNQSALTGGSGKVVNSEPDDTVFFLLR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G20210		DELTAVPE, DELTA...	delta vacuolar processing enzy...		Lus10034797 [exp]	0	1

Compare expression of checked genes

Lus10034797 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.