Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033360 [exp] 91 / 2e-24 AT4G38080 49 / 5e-08 hydroxyproline-rich glycoprotein family protein (.1) Lus10033898 [exp] 78 / 2e-19 AT5G09530 52 / 1e-09 proline-rich protein 10, Pro-Glu-Leu|Ile|Val-Pro-Lys 1, hydroxyproline-rich glycoprotein family protein (.1) Lus10033897 [exp] 62 / 2e-13 ND 51 / 4e-09 Lus10003550 [exp] 62 / 5e-13 ND 51 / 1e-08 Lus10034812 [exp] 61 / 6e-13 ND 51 / 7e-09 Lus10033359 [exp] 61 / 2e-12 ND 54 / 6e-09 Lus10033357 [exp] 60 / 2e-12 AT5G09530 61 / 1e-11 proline-rich protein 10, Pro-Glu-Leu|Ile|Val-Pro-Lys 1, hydroxyproline-rich glycoprotein family protein (.1) Lus10033358 [exp] 61 / 5e-12 ND 57 / 1e-09 Lus10034811 [exp] 52 / 1e-08 AT1G50430 724 / 0.0 PARVA, LEPIDA, DWARF 5, DELTA5,7-STEROL DELTA7 REDUCTASE, Ergosterol biosynthesis ERG4/ERG24 family (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G113700 [exp] 48 / 4e-08 ND / Potri.019G082733 [exp] 44 / 1e-06 ND / Potri.019G082600 [exp] 44 / 2e-06 ND / Potri.013G111566 [exp] 44 / 2e-06 ND / Potri.017G046700 [exp] 43 / 5e-06 ND / Potri.007G114200 [exp] 40 / 3e-05 ND / Potri.017G046400 [exp] 40 / 3e-05 ND / Potri.017G047200 [exp] 39 / 0.0001 ND / Potri.017G045600 [exp] 39 / 0.0001 ND / Potri.017G045800 [exp] 39 / 0.0001 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10034813 pacid=23142311 polypeptide=Lus10034813 locus=Lus10034813.g ID=Lus10034813.BGIv1.0 annot-version=v1.0 ATGGCTTCTTTCAACGGATTCGTACTCTGTCTCTACGTTGCCTTGACATTCTCGACCTTGAATGTTGGCCTAGCCGCTCGCCATCTGCTCCAGCTTCCGA CGCTGCCACCAATTGCCAGCACAATTCCATCTCTGCCAAAGCCAACTCTACCAACGTTGCCACCAATGCCAACTATTCCTATGCCAACACTGCCGACGTT GCCACCAATGCCTACCACCATGCCTGCACTCCCTAAAATTACTACACTGCCCCCACTCTCAAGCATCCCTGCAATGCCGTTGCCAAGCATTCCCAAGGCA ACCTTGCCTCCCATGCCCTCCATCCCAACCATGCCTTCACTCACCCCACCACCTGGAAACTAA
AA sequence Show only first row Show all	>Lus10034813 pacid=23142311 polypeptide=Lus10034813 locus=Lus10034813.g ID=Lus10034813.BGIv1.0 annot-version=v1.0 MASFNGFVLCLYVALTFSTLNVGLAARHLLQLPTLPPIASTIPSLPKPTLPTLPPMPTIPMPTLPTLPPMPTTMPALPKITTLPPLSSIPAMPLPSIPKA TLPPMPSIPTMPSLTPPPGN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G09520		PELPK2	Pro-Glu-Leu|Ile|Val-Pro-Lys 2,...		Lus10034813 [exp]	0	1
AT4G38080			hydroxyproline-rich glycoprote...		Lus10033360 [exp]	2.0	0.9704
AT5G13580		ABCG6	ATP-binding cassette G6, ABC-2...		Lus10001972 [exp]	3.5	0.9655
AT3G11430		ATGPAT5, GPAT5	glycerol-3-phosphate acyltrans...		Lus10040277 [exp]	4.6	0.9650
					Lus10018643 [exp]	5.5	0.9615
					Lus10033359 [exp]	6.5	0.9603
AT5G41040			HXXXD-type acyl-transferase fa...		Lus10032554 [exp]	6.9	0.9617
AT1G28490		OSM1, ATSYP61, ...	syntaxin of plants 61 (.1.2)		Lus10039880 [exp]	7.5	0.9594
AT1G05450			Bifunctional inhibitor/lipid-t...		Lus10021911 [exp]	7.9	0.9551
					Lus10003550 [exp]	8.1	0.9518
AT5G09530		PRP10, PELPK1	proline-rich protein 10, Pro-G...		Lus10017818 [exp]	8.9	0.9547

Compare expression of checked genes

Lus10034813 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.