Lus10034842 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G02290 56 / 1e-09 NAK Protein kinase superfamily protein (.1.2)
AT1G07870 56 / 3e-09 Protein kinase superfamily protein (.1.2)
AT3G02810 53 / 2e-08 Protein kinase superfamily protein (.1)
AT5G16500 53 / 3e-08 Protein kinase superfamily protein (.1)
AT5G18610 51 / 1e-07 Protein kinase superfamily protein (.1.2)
AT5G02800 50 / 2e-07 CDL1 CDG1-like 1, Protein kinase superfamily protein (.1)
AT5G56460 50 / 2e-07 Protein kinase superfamily protein (.1)
AT1G24030 50 / 2e-07 Protein kinase superfamily protein (.1.2)
AT2G17220 50 / 2e-07 Kin3 kinase 3, Protein kinase superfamily protein (.1.2)
AT2G02800 49 / 3e-07 Kin2, APK2B protein kinase 2B (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010703 53 / 2e-08 AT1G24030 578 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10029187 52 / 3e-08 AT1G24030 582 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10012814 51 / 1e-07 AT5G18610 807 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10007041 51 / 1e-07 AT1G76370 236 / 1e-73 Protein kinase superfamily protein (.1)
Lus10033966 51 / 1e-07 AT5G18610 805 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10036499 50 / 2e-07 AT5G18610 575 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10042192 50 / 2e-07 AT2G02800 479 / 3e-168 protein kinase 2B (.1.2)
Lus10008627 50 / 2e-07 AT2G02800 475 / 6e-164 protein kinase 2B (.1.2)
Lus10041426 50 / 2e-07 AT5G18610 582 / 0.0 Protein kinase superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G128500 51 / 9e-08 AT1G61590 622 / 0.0 Protein kinase superfamily protein (.1)
Potri.010G215100 51 / 1e-07 AT5G18610 595 / 0.0 Protein kinase superfamily protein (.1.2)
Potri.009G026500 51 / 1e-07 AT1G07870 595 / 0.0 Protein kinase superfamily protein (.1.2)
Potri.001G002300 50 / 2e-07 AT5G56460 608 / 0.0 Protein kinase superfamily protein (.1)
Potri.006G133300 50 / 2e-07 AT5G02800 566 / 0.0 CDG1-like 1, Protein kinase superfamily protein (.1)
Potri.008G046500 50 / 2e-07 AT5G18610 582 / 0.0 Protein kinase superfamily protein (.1.2)
Potri.008G148000 50 / 2e-07 AT2G02800 604 / 0.0 protein kinase 2B (.1.2)
Potri.008G145900 50 / 2e-07 AT1G24030 587 / 0.0 Protein kinase superfamily protein (.1.2)
Potri.003G166900 50 / 3e-07 AT5G13160 745 / 0.0 avrPphB susceptible 1, Protein kinase superfamily protein (.1)
Potri.018G127300 50 / 3e-07 AT3G01300 498 / 5e-175 Protein kinase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence
>Lus10034842 pacid=23142239 polypeptide=Lus10034842 locus=Lus10034842.g ID=Lus10034842.BGIv1.0 annot-version=v1.0
ATGGACCATCCAAACATCATTAAGCTTATCGGGTATTGTGCTAAAGGGGATAAAGTTCTAATGATGTTGGAGTACTTGACAAGAGGTTCACTAGAAGATA
ACCTCAACAAATTACTAGGTCGAATCACTCGGATATACAAAAAATGCATATGGTCTTGTAGCTTTAGACTCGGTATTGGGCTGGGTCGGAGCCCAAGGAA
CCCCATCCCCAACTCCACCTACAGAAGGAAGATATTAGACTCTACAAGGGGACCAATGGGATGGTGCATTGTCATATGGGCAAGACAAATGCTTCATGAT
CGTGTGGATCATCAACCTGAACTAGAGATGGTTGATCCACATCTGAATGATCAGTTTCTAGAGATTGACCTACGACAAGCTCTCAAAATATGCGAACAGT
GCATAGCGGCTTTATACGAGGTTTTTGGTAAAGATATAGAGTCGATGGTGAATGGCTTCGCTTATCCAGTGTTCAGAGCAGCTATAGGAATGCAGGGCGA
GGAAACTCCATCCTTAAAGCATGTACATCCCTAA
AA sequence
>Lus10034842 pacid=23142239 polypeptide=Lus10034842 locus=Lus10034842.g ID=Lus10034842.BGIv1.0 annot-version=v1.0
MDHPNIIKLIGYCAKGDKVLMMLEYLTRGSLEDNLNKLLGRITRIYKKCIWSCSFRLGIGLGRSPRNPIPNSTYRRKILDSTRGPMGWCIVIWARQMLHD
RVDHQPELEMVDPHLNDQFLEIDLRQALKICEQCIAALYEVFGKDIESMVNGFAYPVFRAAIGMQGEETPSLKHVHP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G02290 NAK Protein kinase superfamily pro... Lus10034842 0 1

Lus10034842 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.