Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G24510 105 / 4e-31 60S acidic ribosomal protein family (.1) AT1G01100 99 / 2e-28 60S acidic ribosomal protein family (.1.2.3.4) AT4G00810 97 / 1e-27 60S acidic ribosomal protein family (.1.2) AT5G47700 97 / 2e-27 60S acidic ribosomal protein family (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002680 [exp] 108 / 7e-32 AT5G24510 122 / 2e-37 60S acidic ribosomal protein family (.1) Lus10028876 [exp] 103 / 2e-30 AT5G24510 128 / 8e-40 60S acidic ribosomal protein family (.1) Lus10008944 [exp] 103 / 2e-30 AT5G24510 128 / 8e-40 60S acidic ribosomal protein family (.1) Lus10008943 [exp] 103 / 2e-30 AT5G24510 128 / 8e-40 60S acidic ribosomal protein family (.1) Lus10030200 [exp] 109 / 3e-29 AT1G05600 580 / 0.0 EMBRYO DEFECTIVE 3101, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10033403 [exp] 43 / 1e-06 AT5G47700 40 / 6e-09 60S acidic ribosomal protein family (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G004700 [exp] 97 / 2e-27 AT1G01100 96 / 4e-27 60S acidic ribosomal protein family (.1.2.3.4) Potri.012G021700 [exp] 92 / 7e-26 AT5G24510 94 / 3e-26 60S acidic ribosomal protein family (.1) Potri.002G179400 [exp] 91 / 2e-25 AT5G24510 99 / 3e-28 60S acidic ribosomal protein family (.1) Potri.014G105400 [exp] 90 / 8e-25 AT5G24510 97 / 2e-27 60S acidic ribosomal protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00428 [flax] [poplar] Ribosomal_60s 60s Acidic ribosomal protein
Representative CDS sequence Show only first row Show all	>Lus10034864 pacid=23142259 polypeptide=Lus10034864 locus=Lus10034864.g ID=Lus10034864.BGIv1.0 annot-version=v1.0 ATGTCCGTGGGAGAAATAGCTTGCAGTTATGCCTTGATGATTCTCCACGACGAGGGCATCCTCGTCACTGCTGATAAAGTCAGCGCATTGGTCAAGGCAG CCAACGTGAACATCGAGTCTTACTGGCCGAGTCTGTTCACCAAGTTGGCCGAGAAGCAAAACATTGCGGATCTTATCATGAACGTTGGTGCTGGTGGCGA CTGTGGTGCTGCTGCCGTTGCTGCACCTGCCGCCGTTCCAGCTGCTGCCGCTGCTGCTCCTGCCGCGGAGCGTAAGAAGGTATGCATTGCTTAA
AA sequence Show only first row Show all	>Lus10034864 pacid=23142259 polypeptide=Lus10034864 locus=Lus10034864.g ID=Lus10034864.BGIv1.0 annot-version=v1.0 MSVGEIACSYALMILHDEGILVTADKVSALVKAANVNIESYWPSLFTKLAEKQNIADLIMNVGAGGDCGAAAVAAPAAVPAAAAAAPAAERKKVCIA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G24510			60S acidic ribosomal protein f...		Lus10034864 [exp]	0	1
AT3G55140			Pectin lyase-like superfamily ...		Lus10003307 [exp]	5.3	0.7746
AT3G58070	C2H2ZnF	GIS	GLABROUS INFLORESCENCE STEMS, ...		Lus10021081 [exp]	6.0	0.8161
AT1G67680			SRP72 RNA-binding domain (.1)		Lus10036924 [exp]	7.7	0.7466
AT2G42990			GDSL-like Lipase/Acylhydrolase...		Lus10029958 [exp]	8.7	0.7761
AT1G66730		AtLIG6	DNA LIGASE 6 (.1)		Lus10033580 [exp]	13.2	0.7548
AT5G18070		DRT101	DNA-DAMAGE-REPAIR/TOLERATION 1...		Lus10007548 [exp]	21.2	0.7335
AT5G58130		ROS3	REPRESSOR OF SILENCING 3, RNA-...		Lus10040584 [exp]	21.5	0.7748
AT3G15130			Tetratricopeptide repeat (TPR)...		Lus10030124 [exp]	21.6	0.7398
AT5G35400			Pseudouridine synthase family ...		Lus10022949 [exp]	27.2	0.7356
AT1G56090			Tetratricopeptide repeat (TPR)...		Lus10008024 [exp]	29.1	0.6944

Compare expression of checked genes

Lus10034864 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.