Plant FIBer expression Database

Lus10034867 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G39840 145 / 1e-41 ATP-dependent RNA helicase, mitochondrial, putative (.1)
AT4G14790 61 / 5e-12 ATSUV3, EDA15 embryo sac development arrest 15, ATP-dependent RNA helicase, mitochondrial (SUV3) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033404
[exp]
171 / 4e-51 AT5G39840 1034 / 0.0 ATP-dependent RNA helicase, mitochondrial, putative (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G081900
[exp]
142 / 7e-41 AT5G39840 1050 / 0.0 ATP-dependent RNA helicase, mitochondrial, putative (.1)
Potri.010G084100
[exp]
57 / 1e-10 AT4G14790 770 / 0.0 embryo sac development arrest 15, ATP-dependent RNA helicase, mitochondrial (SUV3) (.1)
PFAM info
Representative CDS sequence
>Lus10034867 pacid=23142200 polypeptide=Lus10034867 locus=Lus10034867.g ID=Lus10034867.BGIv1.0 annot-version=v1.0
ATGGGTTTGAATCTTAATATTAGGAGAGTAGTGTTTTACAATCTCTCCAAATACAACGGTGACAAGATGGTACCTGTTCCAGCAAGTCAGGTCAAGCAGA
TTGCAGGAAGAGCTGGTAGGAGAGGAAGGCGTTTTCCAGATAGACTCACCACCACCTTGCATTTTGTTGATCTTTCCTATCTGATTGAGTGCTTAAAGCA
ACCTTTTGAGGAAGTTAAGAAAGTAGGACTCTTCCCCTTTTATGAGCAGGTTGAATTACTTGCAGTACAGCTTCCTGGTCTTACCTTTCCTAAGATGCTA
GGATACATTTGGTGA
AA sequence
>Lus10034867 pacid=23142200 polypeptide=Lus10034867 locus=Lus10034867.g ID=Lus10034867.BGIv1.0 annot-version=v1.0
MGLNLNIRRVVFYNLSKYNGDKMVPVPASQVKQIAGRAGRRGRRFPDRLTTTLHFVDLSYLIECLKQPFEEVKKVGLFPFYEQVELLAVQLPGLTFPKML
GYIW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G39840 ATP-dependent RNA helicase, mi... Lus10034867
[exp]
0 1
AT1G36990 unknown protein Lus10029655
[exp]
9.8 0.8727
AT1G74260 PUR4 purine biosynthesis 4 (.1) Lus10030542
[exp]
14.0 0.8541
AT1G13630 Tetratricopeptide repeat (TPR)... Lus10036839
[exp]
14.6 0.8581
AT1G52380 NUP50 (Nucleoporin 50 kDa) pro... Lus10038663
[exp]
16.6 0.8136
AT1G05055 ATGTF2H2, GTF2H... general transcription factor I... Lus10029294
[exp]
17.3 0.8398
AT1G31840 Tetratricopeptide repeat (TPR)... Lus10009465
[exp]
19.6 0.8391
AT1G20960 EMB1507 embryo defective 1507, U5 smal... Lus10025168
[exp]
20.0 0.8704
AT1G03530 ATNAF1 nuclear assembly factor 1 (.1) Lus10022870
[exp]
21.2 0.8536
AT1G03100 Pentatricopeptide repeat (PPR)... Lus10020775
[exp]
22.0 0.8261
AT1G74630 Tetratricopeptide repeat (TPR)... Lus10024222
[exp]
23.7 0.8234

Lus10034867 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.